KEGG   Rattus norvegicus (rat): 246324
Entry
246324            CDS       T01003                                 

Gene name
Rab31, Rab0
Definition
(RefSeq) RAB31, member RAS oncogene family
  KO
K07891  Ras-related protein Rab-22
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    246324 (Rab31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    246324 (Rab31)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    246324 (Rab31)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    246324 (Rab31)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    246324 (Rab31)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 GTP_EFTU Gtr1_RagA TniB AAA_7 AAA_5 NACHT AAA_16
Other DBs
NCBI-GeneID: 246324
NCBI-ProteinID: NP_659562
RGD: 628598
Ensembl: ENSRNOG00000042189
UniProt: Q6GQP4 A0A0G2JSZ1
Position
9q37
AA seq 195 aa
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIW
DTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNK
CDLSDIREVPLKDAKEYAESIGALVVETSAKNAINIEELFQGISRQIPPLDPHENGNSGG
IKLGNQSLQAGRRCC
NT seq 588 nt   +upstreamnt  +downstreamnt
atgatggcgatacgggagctcaaagtgtgtcttctcggggacacgggagttgggaaatca
agcattgtgtgtcggtttgtccaggaccactttgaccacaacatcagccccaccattggg
gcatctttcatgaccaaaactgtgccttgtggaaatgaacttcacaaattcctcatctgg
gacaccgctggtcaggagcggttccattccctggctcccatgtattaccgaggctcggcc
gcagccgtcatagtctatgacatcactaagcaggattcatttcataccttgaaaaaatgg
gttaaggagctgaaggagcatggcccagagaacatcgtgatggcgattgccgggaacaag
tgtgacctatcagatattagggaggtgcccctgaaggatgctaaggagtacgctgaatcc
ataggtgccctcgtggtggagacaagtgcgaagaatgccattaacatcgaggagctcttt
caggggatcagccggcagatcccacccttggacccccatgaaaacggaaacagtggcggg
atcaaactggggaaccagagcttgcaagccggccggcggtgctgctga

DBGET integrated database retrieval system