KEGG   Rattus norvegicus (rat): 293660Help
Entry
293660            CDS       T01003                                 

Gene name
Rhod
Definition
(RefSeq) ras homolog family member D
  KO
K07530  Ras homolog gene family, member D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    293660 (Rhod)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    293660 (Rhod)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Rho Family
   Others
    293660 (Rhod)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA AAA_16 Zeta_toxin ABC_tran PduV-EutP MMR_HSR1 TniB DUF1280 AAA_5 AAA_7 Htr2 Flu_M1 NACHT G-alpha
Motif
Other DBs
NCBI-GeneID: 293660
NCBI-ProteinID: NP_001099793
RGD: 1310985
Ensembl: ENSRNOG00000019220
UniProt: D4ADM8
Position
1q43
AA seq 210 aa AA seqDB search
MNASQTEGEEAPHSGRPIKVVLVGDGGCGKTSLMMVFANGAFPESYNPTVFERYNATLQM
KGKPVRLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCK
GVPIIVVGCKIDLRKDKVLVNTLRKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVE
AVFQEAAEVALSSRSHNFWRRITQNFCVVT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgtcccagactgagggagaggaggcgccgcacagcgggcgtccgatcaaggtg
gtcctagtgggcgacgggggctgcgggaagacgtcactcatgatggtcttcgccaacggg
gccttcccagagagctacaaccccacggtgtttgagcgctataacgccactctgcaaatg
aagggtaaacctgtgcgcctccaaatctgggacacagccgggcaagatgactatgaccgc
ctccggcccttgttctatcctgatgccaatgtcttgctcctctgcttcgatgtgaccaat
ccaaacagttttgacaacgtctccaaccggtggtacccagaggtgacccatttctgcaag
ggggtgcccattattgttgtgggctgcaagatagacctgcgtaaggacaaggtgctggtg
aacacacttcggaagaaaagactggagccggtgacctaccacaggggccatgatatggca
aggtctgtgggagcagtggcctatctcgagtgttcagctcggctccatgacaacgtggaa
gccgtcttccaggaagcagctgaagtggctctcagcagtcgcagtcataacttctggcgg
cggattacccagaatttttgcgtggtcacctga

DBGET integrated database retrieval system