KEGG   Rattus norvegicus (rat): 300160
Entry
300160            CDS       T01003                                 

Gene name
Lrrk2
Definition
(RefSeq) leucine-rich repeat serine/threonine-protein kinase 2
  KO
K08844  leucine-rich repeat kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05012  Parkinson disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    300160 (Lrrk2)
   05022 Pathways of neurodegeneration - multiple diseases
    300160 (Lrrk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    300160 (Lrrk2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    300160 (Lrrk2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    300160 (Lrrk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     300160 (Lrrk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  LRRK family
   300160 (Lrrk2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    300160 (Lrrk2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   300160 (Lrrk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr LRR_8 Roc LRR_4 COR Ras LRR_9 Arf Ank_2 MMR_HSR1 T2SSE PduV-EutP ABC_tran AAA_7 AAA_22 Arm AAA_16 Kdo NB-ARC G-alpha MobB NACHT TniB Gtr1_RagA cobW TrwB_AAD_bind FtsK_SpoIIIE AAA_33 TsaE AAA_29 Septin AAA_18 SRP54 AAA_23
Other DBs
NCBI-GeneID: 300160
NCBI-ProteinID: NP_001178718
RGD: 1561168
Ensembl: ENSRNOG00000004048
Position
7
AA seq 2526 aa
MASGACQGCDEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDILVFTYSDRASKLFEGK
NVHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLI
LKMLTVHHANVNLSIVGLKALDLLLDSGKITLLILDEECDVFLLIFDAMHRYSANEEVQK
LACKALHVLFERVSEEQLTEFVENKDYMTLLSTFRSFKRDEEIVHHVLCCLHSLAVTCSN
VEVLMSGNVRCYNIVVEAMKTFPTSENIQEVSCSLLHKLTLGNFFNILVLNEVHVFVVKA
VQRYPENVALQISALSCLALLTETIFLNQDLEERSETQENSDEDSEKPFWLEPCYKALMR
HRKNKHVQEAACWALNNLLMYQSSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAAA
HALSTLLEQNVNFRKILLAKGVYLNVLELMQRHAQVPEVAESGCKMLSHLFEGSNPSLDT
VAAVIPKILTVMRTHGTSLSVQLEALRALLHFVVPGVSEDSRDDSRCQPNVLRTQCFRTD
IHKLVLAALNRFIGNPGIQKCGLKVISSFAHLPDALEMLSLHGAVDSVLHTLQMYPDDQE
IQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTLQRFKDVAEVQTTGLQTVLSMLDLSVS
FSKLLVHYSFDVVMFHQMSSGVLEQKDEQFLNLCCKCFAKVAVDDELKSKMLERACDQNN
SIMVECLLLLGADANQAKGATSLIYQVCEKESSPKLVELLLNSGCREQDVRKALTVSIQK
GDNQVISLLLRRLALDLANNSICLGGFCIGKLDPSWLGPLFPDKSSNLRKQTNAGSVLAR
KVLRYQMRNTLQEGVASGSEGNFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSEGSESS
FLVKKKSNSVSVGEVYRDLALQRCSPNAQRHSSSLGPVFDHEDLLRRKRKILSSDESLRS
SRLQSHTRQSDSSSSLASEREHITSLDLSANELKDIDALGQKCCLSSHLEHLTKLELHQN
SLTSFPQQLCETLKCLTHLDLHSNKFATFPSFMLKMPSVIHLDASRNDIGPTVVLDPVVK
CPSLKQFNLSYNQLSSIPENLDQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHI
PSLPEDFLEACPKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSL
DMSHNNIEHLPGPAHWKSLNLRELIFSKNQISTLDLSENPHIWSRVEKLHLSHNKLKEIP
PEIGRLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHIGCKAKDIIRF
LQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKSELGMQGATVGIDVRDWPIQIR
GKRKKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKAR
ASSSPVILVGTHLDVSDEKQRKACIGKITKELLNKRGFPTIRDYHFVNATEESDALAKLR
KTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVKEHQ
LQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKH
PKGIISRRDVEKFLSKKKRFPKNYMAQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIE
LPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYLN
WSPEAYCLVGSEVLDSRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDIC
GEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLIL
ADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQEL
VVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADG
LRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAP
EVARGNVIYNQQADVYSFGLLLHDIWTTGNRIMEGLRFPNEFDELAIQGKLPDPVKEYGC
APWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHIFIPKDITVECIAATNLN
SKRATLWLGCGNTEKGQLSLLDLNTERYSYEEVTDSRILCLALVHLAAEKESWVVCGTQS
GALLVINAEDETRRHTLDKMTDSVTCLYCNSFAKQSKQSHFLLVGTADGNLMIFEDKTIK
CKGAAPLKTLHIGDVSTPLMCLSESMNSSERHITWGGCGTKIFSFSNDFTIQKLIETRTN
QLFSYSAFSDSNIIAVAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKIN
KDSKHKLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATA
QLGNLKNVMLVLGYKRKSTEGTQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKM
RKTSVE
NT seq 7581 nt   +upstreamnt  +downstreamnt
atggccagtggcgcctgtcagggctgcgacgaggaagaggaggaggaggctctgaagaag
ttgatagtcaggctgaataatgtccaggaaggcaagcagatcgagacgttgctccagctc
ctggaggacattctggtgttcacctactccgaccgcgcctccaagttatttgaaggcaaa
aatgtccacgtgcctctgttgatagtcctggactcctacatgagagtcgccagtgtgcag
caggtggggtggtcacttctgtgcaaattaatagaagtctgtccagggacattgcaaagc
ttaataggaccccaggatattgggaatgattgggaagtccttggtattcaccgactgatt
cttaaaatgttaactgttcatcatgccaacgtaaacctgtcaatagttggactaaaagcc
ttagatctcctcctagattcaggtaaaattactctgctgatactggatgaagaatgtgat
gttttcctgttaatttttgatgccatgcacagatattcagccaacgaggaagtccagaag
cttgcgtgcaaggctttacatgtgctgttcgagagagtgtccgaggagcaactgactgag
tttgtggagaacaaagattacatgaccctgctgagtacgttccgcagcttcaagagggac
gaggagattgtgcaccatgtactctgctgcctgcattctctggccgtcacttgcagcaat
gtggaggtcctcatgagtgggaatgtcaggtgttacaatattgtggtggaagccatgaaa
acattccccaccagtgaaaacattcaagaggtgagctgctccttgctccacaagcttaca
ttaggtaattttttcaacatcctggtgttgaacgaagtccatgtctttgtggtgaaagcc
gtccagcggtatcccgagaacgtagccttacagatctctgcactcagctgcttagccctc
ctcaccgagactattttcttaaaccaagacctggaagaaagaagtgagactcaggaaaac
agcgatgaggacagtgagaagcctttctggttggaaccctgctataaagccctgatgcgc
catcgaaagaacaaacacgtgcaggaggccgcctgctgggccctaaataatctcctcatg
taccagagcagtttgcacgagaagattggagatgaagatggccagttcccggcgcacagg
gaagtgatgctgtctatgctgatgcactcttcttccaaagacgtcttccaagcagctgcg
catgctctgtccactctcttggaacaaaacgttaatttcaggaaaatcctgcttgcaaaa
ggagtgtacctgaatgtcttggagttgatgcagcggcacgcccaggttcctgaggtggca
gagagtggctgcaagatgctgagtcatctgtttgaaggaagcaacccttctttggataca
gtggcggcagtgatccccaaaatactaacagtgatgagaacccatggaacgtctctgtca
gtccagctggaggcactgcgagctcttctgcattttgtggtgccgggagtatcagaagat
tccagggatgactcgcgatgccaaccaaacgtgctcagaacacagtgcttcaggactgac
atccacaagctggttctagccgctctgaacaggttcattgggaatcccgggattcagaaa
tgtggattgaaagtcatctcttctttcgcacatcttcccgatgccttagagatgttatcc
ctgcatggagcagttgactcagtcctccataccttacagatgtatccagatgaccaagaa
attcagtgtctgggcttacaccttatgggatgcctgatgacaaagaagaatttctgcata
gggacagggcacctcctggcaaaaattctggcttccaccttgcagcgatttaaagatgtt
gctgaagtacagactacaggattacagacggtcttgtcaatgcttgacctgtccgtatct
ttctccaagctgctagtgcactattcatttgatgtggtgatgtttcatcagatgtcttcc
ggtgtcctggaacaaaaggatgagcagtttctcaacttatgctgcaaatgctttgcaaaa
gtggctgtggatgatgagctgaaaagcaagatgctagagagagcctgcgatcagaacaac
agcatcatggtcgaatgtttgctcctcttgggagccgatgccaatcaagcgaagggggca
acttctttaatctatcaggtatgtgagaaagagagcagccctaaattggtggaactattg
cttaacagtgggtgccgtgaacaagatgtacggaaagccctgacagtaagcatccaaaag
ggcgacaaccaggtcatcagcttactcctgaggagacttgccctggacctggccaacaac
agcatttgccttggaggattttgcataggaaaacttgatccttcttggctaggcccttta
tttccagataagtcatctaatttgaggaaacaaacaaatgcggggtctgtcctagcgagg
aaagtgctccggtatcagatgagaaacactcttcaagaaggcgtggcctcaggcagtgag
ggcaacttctctgaggatgcgctggcgaaatttggcgaatggaccttcattcccgactct
tctatggacagtgtgtttggccagagtgacgatctggatagcgaaggcagcgagagctcc
tttctggtgaagaagaagtccaactcagttagtgtaggagaagtttacagggacctagct
ctgcagcgctgctcaccaaatgctcagaggcactccagttccttgggtcctgtttttgat
cacgaagatctactgagacgaaaaagaaaaatactgtcctcagatgagtctctcagatcc
tcaaggctgcagtcccatacgagacaatcagatagctcttcttctctggcttctgagaga
gaacacatcacgtctttagacctttctgccaacgaactgaaagatattgatgctctgggc
cagaagtgttgcctcagtagccacctggagcatctcaccaagctggaacttcaccagaat
tcactcacgagcttcccacaacagctgtgtgagactctgaagtgcttgacacatctggat
ttgcacagtaacaaattcgccacctttccctccttcatgttgaaaatgccaagtgttatc
cacctagacgcctctcgaaatgacatcggaccaacagttgttttagaccctgtggtgaag
tgtccaagcctcaaacagtttaacctgtcctacaaccagctctcttccatcccagagaac
ctggaccaagtggtggagaaactggagcagctcctactggaaggaaacaaaatatccggg
atttgttctcccttgagcctgaaggaactgaagattttaaaccttagtaaaaaccacatt
ccatccctacctgaagactttctcgaggcttgcccgaaagtggagagcttcagtgcccgc
atgaattttctcgctgcaatgcctgccttaccgtcttccataactagcttaaaattgtct
caaaactctttcacgtgcattccagaagcgatcttcagtcttccacacttgcggtccttg
gatatgagtcacaacaacattgaacacctgccgggacctgcacattggaagtctctgaac
ttaagggaactcatttttagcaagaatcagatcagcaccttagacttgagcgaaaaccca
cacatatggtcaagagtagagaagctgcatctctctcataataaactgaaagagattcct
ccagaaattggccgtcttgaaaacctgacatctcttgatgtcagttacaacctggaactg
aggtcctttccaaacgaaatggggaagttaagcaaaatatgggatcttcccttggatgga
ctgcacctcaactttgactttaagcacataggatgcaaagccaaagacatcataaggttt
ctacaacaacgtctgaaaaaggccgtgccctacaaccgaatgaagctcatgattgtgggc
aatacggggagtggtaagaccactctactgcagcagctcatgaaaatgaagaaatcagaa
ctcggcatgcagggcgccacggttggcatagacgtgcgagactggcccatccaaatacga
ggcaaaaggaaaaaggaccttgttctaaacgtgtgggactttgcaggccgtgaggaattc
tacagcactcacccccacttcatgacccagagagccctgtacctggctgtctacgacctc
agcaaggggcaggcggaggtggatgccatgaagccctggctcttcaacatcaaggctcgt
gcctcttcttccccggtgattctggtgggcacacatttggatgtttctgatgagaagcag
cgcaaagcctgcataggcaaaatcacgaaggaactccttaataagcgaggattccccacc
atccgggactaccacttcgtgaatgccactgaggagtcggatgcgctggcaaagctccgg
aaaaccatcataaatgagagtcttaatttcaagatccgagatcagcccgtggttgggcag
ctaattccagattgctacgtagaactggagaaaataatcttatcggagcgtaaagctgta
ccaacggagtttcctgtaattaaccggaaacacttactccagctggtgaaggaacaccag
ctgcagctggatgagaacgagctcccccacgctgttcacttcctgaatgagtcaggagtt
cttctgcattttcaagaccccgcattgcagctgagtgacctgtactttgtggaacccaag
tggctttgtaaagtcatggcacagattttgaccgtgaaagtggacggctgcctgaagcat
cctaagggcatcatttcacggagagatgtggaaaaattcctttccaagaaaaagcgattc
cctaagaactacatggcgcagtacttcaaacttttagaaaaatttcagatcgcattacca
ataggggaagaatatctgctggttccaagcagcttatctgaccacaggccagtgatagag
ctcccccactgtgagaactctgagatcatcatccggctgtatgaaatgccatactttcca
atgggattttggtcaagattgattaaccgattacttgaaatctcacctttcatgctttct
ggaagagagagagcactacgcccaaaccgaatgtactggcgccaaggcatctacttgaat
tggtctccagaagcctactgtctggtgggctctgaagtcttagacagtcgcccagagagt
ttcttgaaaatcacagttccatcttgtagaaaaggttgtattcttttgggccgagttgtg
gatcatattgactcactcatggaagaatggtttcctggattgctggagattgacatttgt
ggggaaggagaaactttgttgaaaaaatgggcattgtatagttttaatgatggcgaagaa
catcagaagatcttgcttgatgagttgatgaagaaggctgaagaaggagacctgttaata
aatccagatcaaccaaggctcaccattccaatatcccagattgctccggacttgatcttg
gctgacctgcctagaaatattatgttgaacaatgacgaactggaatttgaggaagcaccc
gagtttctcttaggtgatggaagtttcggatcagtttatcgagctgcctacgaaggagag
gaagtggctgtgaagatttttaataagcacacatcgcttaggctgttaagacaagagttg
gtggtactctgtcatctccaccatcccagcttgatctccctgttggcggctgggattcgt
cctcggatgctggtaatggagttggcctccaagggttccttggatcgcctgctgcagcag
gacaaagccagcctcacccggaccctccagcacagaatcgcattgcatgtggccgatggc
ctgagatatctgcactcggccatgattatttaccgtgatctgaagccccacaacgtgcta
ctcttcaccctgtatcccaatgccgccatcattgcgaagattgcggactacgggattgca
cagtactgctgtaggatgggaataaagacctcagagggcaccccagggttccgagcacct
gaagttgccagaggaaatgtcatttataaccaacaggctgatgtttattcttttggctta
ctacttcatgatatctggacaactgggaatagaatcatggagggtttgaggtttccaaat
gagtttgatgaactggccatacaagggaaattgccagacccagttaaagaatatggctgt
gccccgtggcctatggttgagaagttaattacaaaatgtttgaaagaaaatcctcaagaa
agacccacttctgcccaggtctttgacattttgaattcagctgagttaatttgcctcatg
cgacacattttcatacctaaggacatcactgttgaatgcatagctgctacaaacctcaat
agcaagcgagcgactctctggttgggctgtgggaacacagaaaaagggcagctttcctta
cttgacttgaacacggaaagatacagctatgaggaagttactgatagtagaatactgtgc
ctggctttggtgcatcttgctgctgagaaagagagctgggttgtgtgtgggacacagtcc
ggagctctcctggtcatcaatgctgaagatgagacaaggagacacaccctcgacaagatg
actgattctgttacttgcttgtattgcaattcctttgccaagcagagcaagcaaagtcac
ttccttttggtgggaactgctgatggcaacttaatgatatttgaagataagaccattaag
tgtaaaggagctgccccattgaagacactacacataggcgatgtcagtacgcccctgatg
tgcctgagcgagtccatgaattcatctgaaagacacatcacatggggagggtgtggcaca
aagatcttctccttttccaatgatttcaccattcagaaactcatcgagacaagaaccaac
cagctgttttcttactcagcgttcagcgattctaacatcatagcggtggcagtggacaca
gcgctttatattgccaagaaaaacagccctgtcgtagaggtgtgggacaagaagacagaa
aaactctgtgaactaatagactgtgtgcacttcttaaaggaggtgatggtgaaaataaac
aaggactcgaagcacaagctgtcctactctgggagggtgaaggcactctgcctgcagaag
aacacagctctctggatcggaactggaggaggccacatcttactcctggatctttctaca
cggcgagtcatccgcaccatccacaatttctgtgattccgtgagagccatggccacagct
cagttaggcaaccttaaaaatgtcatgctggttttggggtacaagcggaagagtacagaa
ggaacccaagaacaaaaagagatacaatcttgtttgtctatttgggacctcaatcttcca
catgaagtgcaaaacttagaaaaacacattgaagtaagaacagaactggctgataaaatg
aggaaaacatctgtcgaatag

DBGET integrated database retrieval system