KEGG   Rattus norvegicus (rat): 308703
Entry
308703            CDS       T01003                                 

Gene name
Lrrk1
Definition
(RefSeq) leucine-rich repeat kinase 1
  KO
K08843  leucine-rich repeat kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308703 (Lrrk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     308703 (Lrrk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  LRRK family
   308703 (Lrrk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr LRR_8 COR Roc LRR_4 Ank_2 Arf Ras Ank_4 Ank_3 Ank Gtr1_RagA MMR_HSR1 TniB
Other DBs
NCBI-GeneID: 308703
NCBI-ProteinID: NP_001178553
RGD: 1308000
Ensembl: ENSRNOG00000012730
UniProt: D3ZRJ7
Position
1q22
AA seq 2013 aa
MAAVSQRPPSMYWCVGTEGSVVCPGPAMETHNGAEDMGSKLSLPGGNSPVQSPNMEEIHT
AYKQRNLSRARDLLREVCEESESPQEKGQLLSISAAHGDLETVRFLLTEKRVELPMEPTD
DNPAVVAAHFGHAEVVHELLESLSGPCASQRLLNWMLALACQRGHLEVVKLLVLTHGADP
ENYAVRKNEFPVIVRLPLYAAIKAGNEDIAIFLLRHGAYFCSYILLDSPDPSKHLLRKYF
IEASALPSSCPGKTALCVKWSHLKLPWVDLDWLLDISCQITELDLSANCLSSLPSIIPWG
LINLKKLNLSNNHLGELPCVQSSDEIICSRLVEIDISSNKLSHLPPGFLHLSKLERLTAS
KNYLERLFEEENATNWIGLRKLEELDLADNRLTELPVQFMHSFKSLTNLNVSRNSLKSFP
DPWSCPLKCCKASKNALESLPDKMAVFWKNHLRDVDFSENSLKAVPLGVFQLDALMFLRL
QGNLLLSLPHHEKWTCRQLKTLDLSRNQLGKNEDGLKTKRISLFTTRGRQRSGTETASVL
EFPAFLSESLEVLCLNDNHLDAVPPSVCLLKNLSELYLGNNPGLRELPPELGQLGNLWQL
DIEDLNIGNVPAEVRKEGPKATLSFLRAQLRKAEKCKLMKMILVGPPRQGKSTLLEILQT
GKAPQPAHSEATVRTTKWELQRPAGSKAKVESVEFNVWDIGGPASMATVNQCFFTDKALY
VVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLA
LCRSPSGSRATGFPDITFKHLHEISCKNLEGQEGLRQLIFHVTCNMKDVGSTIGCQKLAG
RLIPRSYISLQEAVLAEQQRRSLEDQVQYLTDRQLEQLVEQTPGNDIKDYEDLQSAISFL
IETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVG
TGFTQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHSMRHPMANTIQRVFKM
SFVPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVTIYSFTGNQRNRCSTFRVRR
NQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGIKIVCQSEMRDFSAMAFITDHVNSL
IDQWFPALTATESDGTPLMEQYVPCPVCEASWAQHADPNERSESVQYFDMEDCVLTAIEG
NFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHTEGENSILGQGGSGTVIYQA
QYQGQPVAVKRFHIKKFKNSANAPADTMLRHLRAMDAMKNFSDFRQEASMLHALQHPCIV
SLIGISIHPLCFALELAPLGSLNTVLSENAKDSSFMPLGHMLTQKIAYQIASGLAYLHKK
NIIFCDLKSDNILVWSLSVKELINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIV
YDEKVDMFSYGMVLYELLSGQRPALGHHQLQIVKKLSKGIRPVLGQPEEVQFYRLQALMM
ECWDTKPEKRPLALSVVSQMKDPTFATFMYMLPCGKQSSFFSSQSQEYTVVFWDGKEESR
NYTVVNTEKGLLEVQRMTCPGMKLSCQLKVQSSVWLATEDQKIYIYSLKGMCPLSMPQQA
LDTPAVVTCFLAVPVIKKNSFLVLAGLADGLVAVFSMARGTPKESCSYLCSHTANRSKFC
IPDEDSRQNPYPVRAMEVVNSGSEVWYSNGPGLLIIDCAILDISRRLEPYAAPSVVTSLV
CSSDCRGEETVWCLDDKGNSLVMYHSATYQLCARYFCGDPSPLRDTFSVQPSVPESPIRH
ITTSKEPEEECIADVSIMYSEELGMQILTHQDSLTDYCSVSSYSSTPHPDPKSPTSLPSS
LTSYSSVPFSANYEDPDRLQEPSVTPDRTEHDLSPMDGETFSQHLQAVKVLAVQDLIWVP
RHGGDIIVIGLEKDSGAQRGRVIAVLKARELNPHGVLVDAAVVAKDTVVCGFANENTEWC
LAVWRGWGAREFDIFYQSYEELGRLEACPRKRR
NT seq 6042 nt   +upstreamnt  +downstreamnt
atggctgccgtgtcacagcgaccacccagtatgtactggtgtgtggggacagaaggatca
gttgtgtgtccagggcctgccatggagacccataatggtgccgaagacatgggcagcaaa
ctgtctttaccaggtggcaactccccagtgcagagccccaacatggaagaaatccacaca
gcatacaagcagagaaacctctcccgagcccgggacctgctcagggaagtttgtgaagag
agcgaatccccacaggaaaagggccagttgctgagcatctcagcagcccacggggatcta
gagaccgttcggttcctgctcactgagaagcgcgtggagctgccgatggagcccaccgat
gacaacccagctgtggtggcagcgcattttggacatgctgaagtagtacacgaattgctg
gagtccttatcaggtccctgtgcctcgcagcggctgctgaactggatgctggccctggct
tgccagcgagggcacctggaggttgtgaagctgctggtcctgacgcacggggctgacccg
gagaactacgccgtcaggaagaatgagttcccggtcattgtgaggttgcccctctacgcg
gccatcaaggcagggaatgaagacattgccatattcctgcttcggcacggggcctatttc
tgctcctacatcctattggatagccctgacccaagcaaacatctgctcaggaagtatttc
atcgaggccagcgccctgcccagcagctgtcccgggaaaaccgcactttgtgtgaaatgg
tcccatcttaagttgccctgggtggacctcgactggctcttagacatctcctgtcagatc
acagagcttgacctctctgccaactgcctgtcttctctcccctccatcattccttgggga
ctgatcaatctgaagaagctgaacctctcaaacaaccacctgggggagctgccctgtgtg
caatcatcggacgaaatcatctgctccaggttagttgaaatcgacatctccagtaacaaa
ctgtcccacctcccgcctggattcttgcacctctcaaaacttgaaaggctgactgcttcc
aaaaactatctggagcggttgtttgaagaagaaaatgccacaaactggatcggcctgcgg
aagctggaggaactcgacctagctgacaacagactgacggagctccctgtccaatttatg
cactccttcaagtctctcaccaatctgaatgtctccaggaacagcctcaagagctttcca
gacccctggtcctgccctctgaaatgttgtaaagcctccaaaaatgctctggaatcgctg
ccagacaaaatggccgtcttctggaaaaaccacctcagggacgtggatttctccgagaac
tctctgaaagcggtgcccctgggggttttccaacttgatgccctcatgttcttgaggtta
cagggaaacctgctgttgtcactgccacatcatgagaagtggacctgcagacaactcaag
accctggacctctccagaaaccaacttggcaaaaatgaagatgggcttaaaacaaagcgg
atctccctttttaccaccagagggcgccagcgttctggaactgagacagcgtccgtgcta
gaattcccagcttttctaagcgagtctttggaggtcctttgtctgaatgacaaccatctt
gatgcagttcctccgtcagtctgcctgctgaagaacctctcagagctctacttgggcaat
aaccctggtctccgagagctccctccggagctaggccagctgggaaacctctggcaactg
gacattgaagatctgaacattggcaacgtgcctgcagaggtcaggaaagaaggcccaaaa
gcaacgctgtctttcctgcgtgctcagctgcgcaaagcagagaagtgtaaactgatgaag
atgatcctcgtgggccccccacgccagggcaagtccacactcctggagatcttacagaca
gggaaggccccgcagccagcacacagcgaagccactgtcaggaccaccaagtgggagctc
cagagaccagcaggctccaaagccaaggttgagtctgtggagttcaacgtctgggacatc
gggggccctgccagcatggccacagtcaatcagtgcttcttcacagataaggccctatat
gtggtggtctggaacctggccctgggggaagaagctgtggccaacctccagttctggctt
ctcaacattgaggccaaggccccaaacgccgttgtgctggtggttgggacacatctggac
cttatcgaagctaaattccgagtagagaggatcgcaacactgcgtgcctacgtgctggcc
ctctgccgctcaccatcggggtccagagctacaggattcccagacatcactttcaaacac
ttgcacgagatctcctgcaagaatctggaagggcaggaggggctgaggcaactgatcttc
catgtcacgtgcaacatgaaggacgtgggcagcactatcggctgtcaaaaactcgctggc
aggctgatccccaggagctacataagcctacaggaggctgtgctggctgaacaacagcgc
cgcagcctggaagatcaagtacagtacctgacggacaggcagctggagcagctggtggag
cagacgcctggcaatgacatcaaagactatgaggacctgcagtctgccatcagcttcctc
atagaaaccggaaccctgctgcacttcccagacacgagccatggcctaaggaatctctac
ttcctggatcccatctggctctctgaatgcctacagaggatctttaatatcaagggctcg
cggtcggtggcgaagaatggggtgatccgagcagaggacctcaggatgctgctggtgggg
acaggcttcacgcagcagacggaggagcaatacttccagttccttgccaagttcgagatt
gcccttccggttgccaatgacagttacctcctaccacacctcctcccatccaaacctggg
ctggacacccacagcatgcggcacccaatggctaacaccatccagcgggtgtttaagatg
agcttcgtgcctgttggcttctggcaaaggttcatagcacggatgctgatcagcttggct
gagatggacctgcagctttttgaaaacaagaagaatacgaaaagcaggaaccggaaagtc
accatttacagctttacagggaaccagagaaaccgctgcagcacattcagagtccgaagg
aatcagaccatctactggcaggaagggctgctggtcactttcgatgggggctacctcagt
gtggaatcctcagacgtgaactggaaaaagaaaaaaagcggagggattaaaatcgtctgc
cagtcagaaatgagggacttctcagcaatggcttttatcacagaccacgtcaactccctg
atcgaccagtggttccccgccctgacagccacagaaagtgacgggaccccacttatggag
cagtatgtgccctgccccgtctgtgaagcatcctgggcccagcatgcagatccaaacgag
aggtcggagagcgtgcagtacttcgatatggaagattgtgtgctcacagccattgaaggg
aacttcatctcctgccccagacacccagacctcccagtgccacttcaggagcttgtacca
gagctgtttatgactgacttcccagccaggcttttcctggagaacagcaagctggagcac
acagagggtgagaacagcatcctgggccaaggtggcagtggcacagtcatctaccaggcc
cagtaccagggccagcctgtggctgtgaagagattccacatcaagaagttcaagaattct
gctaatgccccggcagacaccatgctgaggcacctgagagccatggatgccatgaagaac
ttctcggatttccgtcaggaggccagcatgctgcatgccttgcagcacccctgcattgtg
tcactcatcggcatcagcatccaccccctctgcttcgccctggagctcgccccgctgggc
agcctcaacactgtgctgtctgagaatgccaaagattcttcctttatgcccctgggacac
atgctcacccaaaaaatagcctaccagattgcctcgggcctggcctacctgcacaagaag
aacatcatcttctgtgacctcaagtcagacaacatcctggtgtggtcactgagcgtcaag
gagctcatcaacatcaaactgtcagactacggcatctcgaggcagtcctttcacgagggg
gccctgggtgtggagggcaccccaggctaccaggctccagagatcaggcctcgcattgtg
tatgacgagaaggtagacatgttctcctatggcatggtgctgtatgagctgctctcagga
cagcgtcctgcgctgggccaccaccaacttcagattgtcaagaagttgtccaagggcatc
cgcccagtgctggggcagccagaggaagtgcaattctatcgactgcaggcgctcatgatg
gagtgctgggacacgaagccggagaagcgtcccctggccctgtctgtggtgagccagatg
aaagacccaaccttcgccaccttcatgtacatgctgccctgtgggaagcagtcgtccttc
ttctcatcccagagccaggagtacactgtggtgttctgggatgggaaggaggagtcaagg
aattacacggtggtcaacaccgagaagggccttctggaagtacagaggatgacctgtcct
gggatgaagctgagctgtcagctcaaggtccagagctcagtgtggctagccaccgaggac
cagaaaatctatatctacagccttaagggtatgtgcccattaagcatgccccagcaggcc
ctggacacgccggctgttgtcacctgtttcttggcagtacctgttattaaaaagaactcc
tttctggtgctggctggcctggctgatggactcgtggctgtgttttctatggcacggggc
accccaaaagaaagctgctcctacctgtgctcgcacacagccaacaggtccaagttctgc
atcccagacgaagactcacggcagaacccctacccagtgagggcaatggaagtggtcaac
agcgggtctgaggtctggtacagcaatgggccaggcctcctcatcatcgactgtgccatc
ctggacatcagcaggcggctggagccctatgcagccccatctgtggtcacatcacttgtg
tgcagctcagactgcagaggagaggagacagtctggtgcctggacgacaagggcaattcc
ttagtgatgtaccattcagccacctaccagctgtgtgcccggtacttctgcggggacccc
agtcctctcagggacacgttttctgtacagccctcagtcccagaaagcccaatccgtcac
ataaccacctcaaaggagcctgaggaagagtgcatcgccgacgtgagcatcatgtacagc
gaggagctgggcatgcagatcctcacccaccaggactcgctcactgactactgctccgta
tcctcgtactcatccacaccccacccagaccccaagtcccccaccagcctgcccagctcc
ctcaccagctattccagtgtgcctttctccgccaattatgaagacccagacaggctgcag
gagcccagcgtcacccctgacagaactgagcatgatctgagccccatggatggggagacg
ttcagccaacacctgcaggctgtgaaggtgcttgctgtccaagacctcatttgggtccct
agacatggtggagatatcattgtcatcggcctggagaaggattcgggtgcccagcggggc
agggtcatcgctgttttaaaagccagagagctcaatccgcatggggtcctggtggatgcg
gcagtggtggcaaaggacaccgtagtgtgcggctttgcaaacgaaaacacagagtggtgc
ctggctgtctggaggggctggggcgccagggagtttgacatcttctaccagtcctatgag
gagctgggccggctggaggcgtgtcctcgcaagagaaggtaa

DBGET integrated database retrieval system