KEGG   Rattus norvegicus (rat): 360720
Entry
360720            CDS       T01003                                 

Gene name
Rabl3
Definition
(RefSeq) RAB, member of RAS oncogene family-like 3
  KO
K07933  Rab-like protein 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    360720 (Rabl3)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Unclassified
   360720 (Rabl3)
SSDB
Motif
Pfam: Roc Ras MMR_HSR1 Gtr1_RagA Arf RsgA_GTPase AAA_16 IIGP AAA_5 AAA_29 ABC_tran DUF87 DUF815 Septin Sigma54_activat
Other DBs
NCBI-GeneID: 360720
NCBI-ProteinID: NP_001101789
RGD: 1306436
Ensembl: ENSRNOG00000026085
UniProt: D4A1C1
Position
11q21
AA seq 236 aa
MASLDRVKVLVLGDSGVGKSSLVHLLCHNQVLGNPSWTVGCSVDIRVHDYKEGTPEEKTY
YIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEVLNRDAVP
TGVLVTNGDYDREQFADNQIPLLVIGTKLDQIHETKRHEVLIRTAFLAEDFNAEEINLDC
TNPRSSAAGSSNAVKLSRFFDKVIEKRYLFREGNQIPGFSDRKRFGGGTLKNFHCD
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcgtccctggatcgagtgaaggttctggtgttgggagactcaggtgttgggaaatct
tcactcgtccatcttctgtgccacaatcaagtgttaggaaatccatcatggactgtggga
tgctcagtggatatcagagttcatgactacaaagaagggacccctgaagagaagacctac
tatatagaactatgggatgttggaggctctgtgggcagtgccagcagtgtgaaaagcaca
agagcggtgttctacaactctgtaaatggcatcattttagtacatgacttaaccaataag
aagtcatctcaaaacttataccgctggtccttggaagttctcaatagggatgcagttcca
accggagtcctggtgacaaatggggattatgaccgagaacagtttgctgataatcaaatc
ccactgttggtgatagggactaaactggaccagattcatgaaaccaagcgccatgaggtt
ttaatcaggaccgccttcttggctgaggacttcaatgctgaagagattaatttggattgc
acaaacccacggtcctcagctgcaggctcctccaacgctgtcaagctcagtagatttttt
gataaggtcatagaaaagagatatttgtttagagaaggtaatcagattccgggcttttcc
gataggaagaggtttggaggagggacactgaagaacttccactgtgactga

DBGET integrated database retrieval system