KEGG   Rattus norvegicus (rat): 81754
Entry
81754             CDS       T01003                                 

Gene name
Rab1a, Ac2-048, Rab1, Rab1r
Definition
(RefSeq) RAB1A, member RAS oncogene family
  KO
K07874  Ras-related protein Rab-1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05014  Amyotrophic lateral sclerosis
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    81754 (Rab1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81754 (Rab1a)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    81754 (Rab1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81754 (Rab1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81754 (Rab1a)
   04031 GTP-binding proteins [BR:rno04031]
    81754 (Rab1a)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    81754 (Rab1a)
 Autophagy
  Other autophagy associated proteins
    81754 (Rab1a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   81754 (Rab1a)
  Exosomal proteins of other body fluids (saliva and urine)
   81754 (Rab1a)
  Exosomal proteins of colorectal cancer cells
   81754 (Rab1a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    81754 (Rab1a)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 SRPRB Gtr1_RagA AAA FeoB_N AAA_16 PduV-EutP AAA_7 AAA_29 AAA_22 ABC_tran Septin AAA_5 LANC_like TniB
Other DBs
NCBI-GeneID: 81754
NCBI-ProteinID: NP_112352
RGD: 619736
Ensembl: ENSRNOG00000004992
UniProt: Q6NYB7
Position
14q22
AA seq 205 aa
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI
KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL
LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA
TAGGAEKSNVKIQSTPVKQSGGGCC
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtccagcatgaatcccgaatatgattatttattcaagttactcctgattggcgactct
ggggttggaaagtcttgccttctccttaggtttgcggatgacacgtatacggaaagctac
atcagcacgattggtgtggatttcaagatacggactatagagctagacgggaaaacaatc
aagcttcagatatgggacacagcaggccaggaaagatttcgaacaatcacctccagttat
tacagaggagcccatggcatcatagttgtgtatgatgtgacagaccaggagtccttcaat
aacgtgaaacagtggctgcaggagatcgatcgctacgccagcgaaaatgtcaacaagttg
ttggtagggaacaaatgtgacctgaccacaaagaaagtagtagactacacaacagccaag
gaatttgcagattcccttggaattccatttttggaaaccagtgctaagaacgcaacgaat
gtagaacagtctttcatgaccatggcagcggagattaaaaagcggatgggtcctggagca
acagctggaggtgcggagaagtccaatgttaaaatccagagcactccagtcaagcagtca
ggtggaggctgctgctaa

DBGET integrated database retrieval system