KEGG   Rattus norvegicus (rat): 84009
Entry
84009             CDS       T01003                                 

Gene name
Kalrn, Duo, Hapip, Kalirin
Definition
(RefSeq) kalirin, RhoGEF kinase
  KO
K15048  kalirin [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    84009 (Kalrn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84009 (Kalrn)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    84009 (Kalrn)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     84009 (Kalrn)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  Trio family [OT]
   84009 (Kalrn)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    84009 (Kalrn)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84009 (Kalrn)
SSDB
Motif
Pfam: RhoGEF Pkinase Spectrin SH3-RhoG_link PK_Tyr_Ser-Thr I-set Ig_3 fn3 PH ig SH3_1 PH_10 Ig_2 SH3_9 PH_19 CRAL_TRIO CRAL_TRIO_2 SH3_2 IQ_SEC7_PH PH_13 V-set RL11D T4_Rnl2_C
Other DBs
NCBI-GeneID: 84009
NCBI-ProteinID: NP_114451
RGD: 621865
Ensembl: ENSRNOG00000001706
UniProt: P97924
Structure
PDB: 
5O33 2KR9 1U3O

Position
11q22
AA seq 2977 aa
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARTNHDRIRQEDLRKLVTNLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEVLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPTE
ARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIM
EVQASGIELICEKDVDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQA
GHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRD
EDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPS
VASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQET
GEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEI
RKWVTTVDKHYRDFSLRMGKYRYTLEKALGVNTEDNKDLELDIIPASLSDREVKLRDANH
EVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHII
FGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEH
AGTFFDEIQQRHGLANSISSYLIKPVQRVTKYQLLLKELLTCCEEGKGELKDGLEVMLSV
PKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSK
EIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQ
EWIKNIREVIQERIIHLKGALKEPIQLPKTPAKLRNNSKRDGVEDGDSQGDGSSQPDTIS
IASRTSQNTVESDKLSGGCELTVVLQDFSAAHSSELSIQVGQTVELLERPSERPGWCLVR
TTERSPPQEGLVPSSTLCISHSRSSVEMDCFFPLVKDSYSHSSGENGGKSESVANLQSQP
SLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGD
ETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLAARQAPTDVP
TAADLVSAIEKLVKSKLTLEGGSYRGSLKDPTVCLNEGMAPPTPPRNLEEEQKAKALRGR
MFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKEKIVFGNIHQIYDWHKDFF
LAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDAYFEEVKQEINQRL
TLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRL
QGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYM
FKRSIKMNYLVLEEDVDDDPCKFALMNRETSERVILQAANSDIQQAWVQDINQVLETQRD
FLNALQSPIEYQRKERSTAVIRSQPPRVPQASPRPYSSVPVGSEKPPKGSSYNPPLPPLK
ISTSNGSPGFDYHQPGDKFDASKQNDLGGCNGTSTMAVIKDYYALKENEICVSQGEVVQV
LAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLTKATAPAESSDESIKKSCSWHTLRMR
KRADVENTGKNEATGPRKPKDILGNKASVKETNSSEESECDDLDPNTSMEILNPNFIQEV
APEFLVPLVDVTCLLGDTVLLQCKACGRPKPTITWKGPDQNILDTDNSSATYTISSCDSG
ESTLKICNLMPQDSGIYTCIATNDHGTASTSATVKVQGVPAAPNRPIAQERSCTSVILRW
LPPASTGNCTISGYTVEYREEGSQVWQQSVASTLDTYLVIEDLSPGCPYQFRVSASNPWG
ISLPSEPSEFVHLPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKKCIHKATRKD
VAVKFVSKKMKKKEQAAHEAALLQHLQHPQYVTLHDTYESPTSYILILELMDDGRLLDYL
MNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVKLIDLEDAV
QISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFLDESKEETC
INVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPHNGSYSKIP
LDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT
NT seq 8934 nt   +upstreamnt  +downstreamnt
atgacggaccgcttctgggaccagtggtatctttggtatctccgcttgcttcggcttctg
gatcgaggatcttttcggaatgatggtttgaaagcttctgatgtccttcctatcctaaag
gagaaagtggcctttgtgtctgggggtcgtgataagcgaggtggacccatcctgaccttc
cctgcccgaaccaatcatgacagaataagacaggaagacctacggaaactcgtgacgaat
ttggccagcgtgccaagcgaggacgtttgcaaacgtggcttcaccgtcatcatcgacatg
cggggctccaagtgggacctcatcaagcccctcctcaagacgctgcaggaagcctttccc
gccgagatccatgtggccctcatcatcaagcctgacaacttctggcagaagcagaagacc
aactttggcagctccaaattcatctttgagacgagcatggtgtctgtggagggcctcacg
aagctggtggacccctcccagctgacagaagagtttgacggttccctggattacaaccac
gaggagtggattgagttgcgcctctccctggaggagttcttcaacagtgcggtccacctg
ctctcacgcctcgaggacctgcaggagatgctggcccggaaggagttccctgtggatgtg
gagggctctcggaggcttatcgacgagcacacacaacttaagaaaaaggtgctgaaggcc
cccgtggaagagctggaccgggaggggcagcggctactgcagtgtatccgctgcagtgat
ggcttctcagggcgcaactgcatcccaggaagtgccgacttccagagccttgtacccaag
atcaccagcctcctggacaagctgcattccacccgacaacacctgcaccagatgtggcac
gtccgaaagctcaagctggatcagtgcttccagctgcggctcttcgagcaggatgccgag
aagatgttcgactggataagccacaacaaggagttatttcttcagagccacacagagatc
ggagtcagctaccagcatgcactagacctccagacacagcacaatcactttgccatgaac
tccatgaatgcctatgtcaacatcaaccgcatcatgtctgtcgcatcccgcctctcagag
gctggccattatgcctcccagcaaatcaagcagatctccacgcagctagaccaggagtgg
aagagctttgctgctgccctggatgaacgcagtacaatcctggccatgtctgctgtgttc
caccagaaggcagagcagttcctgtcaggagtggatgcctggtgtaagatgtgcagtgaa
ggcggccttccttctgagatgcaggacctggagctggcaatccaccatcaccagtccttg
tatgagcaggtgacccaggcctacacagaggtcagccaggatgggaaagcactcctggat
gtcctgcagcgtcccctgagccctgggaactccgagtccctcacagccacagccaactac
tccaaggcggtacaccaggtgctggatgtggtacatgaggtgctgcaccaccagcggcgg
ctcgagagcatctggcagcaccgtaaagtgcggcttcaccagcggctgcagctgtgcgtc
ttccagcaggatgtgcagcaggtgctggactggattgaaaaccacggtgaggcctttctc
agcaaacacactggggtcggcaagtccctgcatcgggcacgggcattgcagaagaggcat
gatgactttgaagaggtggctcagaatacatacaccaatgcggacaagctcctagaggca
gcagagcagctggctcagactggggaatgtgacccggaagagatctacaaggctgcccga
cacctggaggtgcgcatccaagacttcgtgcgcagagtggagcagcggaagcttcttctg
gacatgtccgtctctttccacacgcacaccaaagagctgtggacatggatggaagacctt
cagaaggaggtgctggaggatgtctgtgcagactctgtggatgcggtccaggaactgatc
aagcagttccagcagcagcagaccgctaccctggacgccactctcaacgtcatcaaggaa
ggcgaagaccttatccagcagctcaggtcagcgcctccctccctgggggagcccaccgag
gccagggactcagctgtatccaacaacaagacgccccacagtagttccatcagccatatc
gagtctgtcctccagcagctggacgatgctcaggtacagatggaggagctgtttcacgag
cggaagatcaagctggacatcttcctgcagctgcgcatcttcgaacagtacaccattgag
gtcaccgcagagctggatgcctggaatgaggacttgctccggcagatgaatgacttcaac
acagaggacctgaccctggcagagcagcggctacagcgccacacagaacggaagcttgcc
atgaacaacatgacattcgaggtcatccagcagggccaggacctgcaccaatatatcatg
gaagtccaagcctcaggaatcgagttaatctgtgagaaggacgttgacctggcagctcag
gtgcaagagctactggaatttctccatgagaagcagcacgaactggagctcaatgcggag
cagacgcacaagcggctagagcagtgtctccagctgcggcacctccaggctgaggtcaaa
caggttctgggatggatccgcaatggagagtccatgctcaacgccagcctggtcaatgcc
agctctttgtctgaggcagagcagctacagcgggagcacgaacagttccagctagccatc
gagaagacgcaccagagcgccctgcaggtacagcagaaggcagaggcactgctccaggcc
ggccactatgacgccgatgctatccgggaatgtgcggagaaggtggccctccactggcaa
cagctcatgctaaagatggaggaccggctgaaactcgtcaatgcctctgtggccttttac
aagacctctgagcaggtgtgcagcgttctggagagcttagagcaggagtaccggagagac
gaagactggtgcggcgggagagacaagctggggccggcggcagagatggaccacgtcatt
ccactcctcagcaagcatctggagcagaaggaggccttcctgaaggcctgcactctggca
cggcggaatgccgaggtgttcctcaagtacatccacaggaacaatgtgagcatgcccagt
gttgccagccacaccaggggacccgaacagcaagtaaaagccatcttgagtgagctcttg
cagagagagaatcgcgtcctgcacttctggaccttgaagaagcggcggttagaccagtgt
cagcaatatgtggtgtttgaacgcagtgctaaacaggcactagactggatccaagaaaca
ggagaatattacctctcaacccatacctccactggagagaccacagaggagactcaggag
ctgctgaaagagtatggagaattcagggtgcctgccaagcaaacaaaagagaaggtgaag
cttctgatccagctagcagacagctttgtggaaaagggccacatccatgccacagagata
cggaaatgggtgaccacggtggacaagcactaccgggatttctccctgaggatggggaag
taccggtacaccctggagaaagccctgggagtcaacacggaggataacaaggacctagag
ctggacattatcccagcaagcctttcagaccgggaggtcaagctccgggatgctaaccac
gaggtcaatgaagagaaacggaagtcagctcgaaagaaagaattcattatggctgaactg
ctccagaccgagaaggcttatgtaagagacctacacgagtgcttggagacctacctgtgg
gaaatgaccagtggtgtggaagagataccacctgggatcctcaataaggagcacatcatc
ttcggcaacatccaggagatctatgacttccacaacaacatcttcctcaaagagctggag
aagtacgagcagctgcctgaggatgtgggacactgctttgttacctgggcagacaaattt
cagatgtatgtcacctactgtaaaaacaagcctgattccaaccagctgatcctggagcac
gcaggcaccttctttgatgagatccagcagcggcacgggctggccaactccatctcttcc
tacttaattaagcctgtccagagagttacgaagtaccagctgctcctgaaggaactttta
acttgctgtgaagaagggaaaggggagctcaaggatggcctggaggtgatgctcagtgtc
cccaagaaagccaatgatgccatgcatgtcagcatgcttgaagggttcgatgagaacttg
gatgtacagggggagttgattctccaggatgcctttcaagtgtgggacccaaagtcgctg
atccggaaggggcgggaacggcatctgttcctctttgagatctccttggtgtttagcaaa
gagatcaaagactcttcaggacacacgaaatatgtttacaagaacaagctactgacctca
gagctgggtgtgaccgagcacgtagaaggtgacccctgcaaattcgccttgtggtctggg
cgcaccccatcctcagacaataaaacagtgctcaaagcttccaacatcgaaaccaagcag
gaatggatcaagaacattcgggaagtgattcaggaaaggatcattcatcttaaaggagct
ttaaaggagccaatccagctccccaaaacaccagccaaactgaggaacaatagtaagagg
gatggggtagaggatggtgacagccagggggacgggagcagccagcccgataccatatcc
attgcctccaggacctctcagaacacagtggagagtgacaagctctcaggtggatgtgag
ctgaccgtggtcctccaggacttcagcgcggcccacagcagtgagctgagcatccaggtg
gggcagactgtggagctgttggaacgacccagtgagagacccggctggtgtctggtccgc
accacagagcggagccccccacaggaaggcctggtccccagcagcaccttgtgcatctca
cactcgagaagcagcgtggaaatggactgcttcttccccctggtgaaagattcatactct
cattcctccggtgagaatggaggcaagtctgagtccgtggccaacctgcagtctcagccc
tccctgaactccatccacagttcccctggtcccaagcgctccaccaacacccttaagaag
tggctgacgagccctgtgcgtcggctcaacagcgggaaagcagacggaaacatcaaaaag
cagaagaaagtacgggatgggcggaagagcttcgacctgggctcacccaagccaggggac
gagacaacccctcagggagacagcgctgatgagaagagcaagaaaggttggggagaagat
gagccagatgaagagtcacacacacctctccccccgcccatgaagatctttgacaacgac
cccacccaggatgagatgtcctctttgctagcagcccggcaggctcccactgacgtgcct
actgctgcagaccttgtcagtgcaatagaaaagttggtcaaaagtaagctgactctggaa
ggaggctcttaccgggggagcttgaaggaccctacagtctgcctgaatgaggggatggcc
cctcccacacctcctagaaacctggaagaagaacagaaagccaaggctctaagaggcagg
atgtttgtcctgaatgagttggtgcagacagagaaggactacgtcaaggacctggggatt
gtggtggagggcttcatgaaaagaatagaagagaagggggtccccgaggacatgcgaggg
aaggaaaagatcgtgtttggaaacatccaccagatttacgactggcataaagattttttc
ctggctgaactggaaaaatgcatccaagagcaagacagattggcccagctcttcattaaa
catgagcggaagctgcacatctatgtgtggtactgccagaacaaaccacgttccgaatac
atcgtggctgaatatgatgcctactttgaggaggttaaacaagagatcaatcaaaggctg
acccttagtgacttcctcatcaagcccattcagagaataacaaagtaccagctgctactc
aaggacttcctgcggtacagcgagaaggctggtttggagtgttctgatattgagaaagca
gtggagttaatgtgccttgtccccaagcgctgtaatgacatgatgaatctgggacgcctg
cagggctttgagggcaccctgaccgcccagggcaagcttctacagcaggacacgttctat
gtgattgagctggatgctggcatgcagtcccggaccaaggagaggcgtgtgtttctcttt
gagcagattgtcatctttagtgaactgctccgaaagggatccctcaccccaggctacatg
ttcaagaggagcatcaagatgaattacttggttctggaagaagatgtggatgatgacccc
tgcaaatttgcacttatgaacagggagacttcagaaagggtcattctgcaggccgccaac
tcagacatccagcaggcctgggtgcaggacatcaaccaagtcctagaaacacagagggac
ttcttaaatgctctgcagtcacccatcgagtatcagcggaaggagaggagcacagctgtg
atccggtcccagccccctagggttcctcaagccagccccaggccctattcgtctgtccca
gtgggctcagagaaaccccccaagggctccagctacaacccgcccctgccacccctgaaa
atatctacctcgaatggcagtccagggttcgactaccaccagcctggggacaagtttgac
gctagcaagcagaacgacctgggaggctgcaatgggacctcaaccatggccgtaattaaa
gattactatgcactgaaggagaacgaaatctgtgtgagccaaggtgaggtggtccaggtc
ctcgccgtcaaccagcagaacatgtgtctggtgtaccagcctgccagcgaccattcccca
gcagcggagggctgggtcccaggcagcatcctggcacccctcaccaaagccacagcgccg
gccgagagtagtgatgagagcatcaagaagtcatgctcatggcacactctacgcatgaga
aagcgggcagacgtggagaacacgggtaaaaatgaagccacagggcctcgtaaacccaag
gatattctgggcaacaaagcctctgttaaagagacgaacagttccgaggagtcagagtgt
gatgatcttgaccctaatactagtatggagatcttgaatccgaatttcatccaggaagtg
gctccggaattccttgtgcccttggtagatgtgacctgcttgctcggagacacagtactg
ctacagtgcaaagcctgtgggcggccaaagcctaccatcacctggaagggtccagatcag
aacatcctagacaccgacaacagttcagccacatacaccatctcctcctgtgattctggg
gaaagcaccctcaagatctgcaacctgatgccccaagacagcgggatttatacctgcata
gcaacaaatgaccacggaaccgcatccacgtctgctacagttaaggtgcaaggtgtaccc
gcagcccccaatcgcccaatcgcacaggagaggagctgcacctccgtcatcctccgctgg
ctgcccccagccagcaccggaaactgcactatttcggggtacacagtggagtaccgcgag
gaaggttcgcaggtctggcagcagtcggtagcttcaaccttggacacttacctagtcatt
gaagatcttagtccagggtgcccttatcagttcagggtcagcgccagcaacccctgggga
atcagccttcccagtgagccctcggagtttgtgcaccttccagagtacgatgcagctgct
gatggtgccaccatttcttggaaggaaaattttgattctgcttacaccgaactgaacgag
attggcagaggccgtttctctattgtaaagaaatgcattcacaaagctacccgcaaagac
gttgctgtgaaatttgtgagcaagaaaatgaaaaagaaggaacaggctgcgcacgaggcc
gccctgctccagcacctgcagcacccccagtacgtcaccctccacgacacctacgagtcc
cccacatcctacatcctgattttggaactgatggatgacggccgactcttggactaccta
atgaatcacgatgagctgatggaagaaaaggtagctttctacattcgagacatcatggaa
gctctgcagtaccttcacaactgcagggtggcacatttggacataaagcctgaaaacctc
ctcattgacctccggatcccagtgcctcgagtgaaactcatcgacttggaagatgctgtc
cagatctcaggccacttccacatccaccatctgctggggaaccctgagtttgctgccccg
gaagtgatccaaggcatccctgtctccctgggcacagacatctggagcatcggggttctg
acctacgtcatgcttagcggggtctcccccttcttagatgagagcaaagaggagacctgc
atcaacgtgtgcagggtggacttcagcttcccccacgaatacttctgcggtgtaagcaat
gctgccagggacttcatcaacgtcatcttacaggaagacttccggaggcggcccacagca
gccacgtgcctgcagcatccgtggctgcagccccacaacggcagctactccaagatcccc
ttggatacctcccgcctggcctgcttcatagagcgccgcaagcaccagaatgacgtgcgg
cccattcccaatgtcaaaagttacatcgtcaacagggtgaaccaggggacctag

DBGET integrated database retrieval system