KEGG   Saccharomyces cerevisiae (budding yeast): YFL005W
Entry
YFL005W           CDS       T00005                                 

Gene name
SEC4, SRO6
Definition
(RefSeq) Rab family GTPase SEC4
  KO
K07901  Ras-related protein Rab-8A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YFL005W (SEC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YFL005W (SEC4)
   03036 Chromosome and associated proteins [BR:sce03036]
    YFL005W (SEC4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YFL005W (SEC4)
   04031 GTP-binding proteins [BR:sce04031]
    YFL005W (SEC4)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    YFL005W (SEC4)
 Autophagy
  Other autophagy associated proteins
    YFL005W (SEC4)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    YFL005W (SEC4)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YFL005W (SEC4)
  Exosomal proteins of other body fluids (saliva and urine)
   YFL005W (SEC4)
  Exosomal proteins of colorectal cancer cells
   YFL005W (SEC4)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    YFL005W (SEC4)
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA MMR_HSR1 RsgA_GTPase GTP_EFTU FeoB_N MCM AAA_7 AAA_22 PduV-EutP AAA DUF815 AAA_16 DUF4938
Other DBs
NCBI-GeneID: 850543
NCBI-ProteinID: NP_116650
SGD: S000001889
UniProt: P07560
Structure
PDB: 

Position
VI:130334..130981
AA seq 215 aa
MSGLRTVSASSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIK
TVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNE
HANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLI
QEKIDSNKLVGVGNGKEGNISINSGSGNSSKSNCC
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtcaggcttgagaactgtttctgcttcatccggtaatggaaagagctatgactctatt
atgaaaattttattgattggtgattctggtgttgggaaatcatgtttattggttcgtttt
gttgaagacaaatttaacccgtcatttatcaccaccattggtattgatttcaaaataaag
actgtcgatatcaacggtaagaaggtaaagctgcaactttgggataccgctggtcaagaa
cgtttccggacaatcaccacagcgtattatcgtggtgctatgggtatcattcttgtatat
gatgtgacagacgagagaacatttactaatatcaagcaatggtttaaaaccgttaatgag
catgcgaacgatgaagcacagctactgttggttggtaacaagagcgatatggagacgaga
gtggtaacagctgatcaaggtgaagccttggctaaggagctgggtataccattcatcgag
tccagtgctaagaacgatgacaatgtcaacgagatttttttcaccttggcgaagttaatc
caagaaaaaatcgacagtaacaagcttgttggcgtcggtaacggtaaagagggcaatatt
agcatcaatagtgggagcggaaacagttctaaatcaaattgctgttga

DBGET integrated database retrieval system