KEGG   Saccharomyces cerevisiae (budding yeast): YFL038C
Entry
YFL038C           CDS       T00005                                 

Symbol
YPT1
Name
(RefSeq) Rab family GTPase YPT1
  KO
K07874  Ras-related protein Rab-1A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YFL038C (YPT1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YFL038C (YPT1)
   04031 GTP-binding proteins [BR:sce04031]
    YFL038C (YPT1)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    YFL038C (YPT1)
 Autophagy
  Other autophagy associated proteins
    YFL038C (YPT1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YFL038C (YPT1)
  Exosomal proteins of other body fluids (saliva and urine)
   YFL038C (YPT1)
  Exosomal proteins of colorectal cancer cells
   YFL038C (YPT1)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    YFL038C (YPT1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase SRPRB AAA_7 Septin AAA_5 ABC_tran AAA_16 AAA_29 AAA_22
Other DBs
NCBI-GeneID: 850505
NCBI-ProteinID: NP_116615
SGD: S000001856
UniProt: P01123
Structure
PDB: 
2BCG 1UKV 1YZN 3CUE

Position
VI:complement(55366..55986)
AA seq 206 aa
MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQ
IWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVG
NKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE
TTQKKEDKGNVNLKGQSLTNTGGGCC
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaatagcgagtacgattacctgttcaaactgctgttgatcgggaattccggtgtcggg
aagtcctgtttacttttgaggttttcggacgacacatataccaacgactacatctccaca
attggagtggacttcaagattaagactgtagaactggacggcaagactgtaaagctacag
atttgggacactgcaggtcaagaacgtttccgtactatcacttcatcttactaccgtggt
tcgcatgggatcattatcgtgtatgatgtcactgaccaagaatccttcaacggcgtgaag
atgtggctgcaagagattgatcggtatgcaacctcaacagtgttgaagctattggtaggt
aacaagtgtgatttaaaggacaagcgtgtcgtggaatatgacgtggcaaaggaatttgcg
gacgcgaataagatgccgttcttagagactagtgctttggactccaccaacgtcgaggat
gcgtttttaaccatggctagacaaatcaaggaaagtatgtcccaacaaaacctgaacgaa
accactcagaagaaggaagacaaagggaacgtcaacctgaagggacagagtttaaccaac
accggtgggggctgctgttga

DBGET integrated database retrieval system