KEGG   Stenotrophomonas maltophilia K279a: Smlt1291
Entry
Smlt1291          CDS       T00718                                 
Symbol
trbB
Name
(GenBank) putative conjugal transfer protein
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sml00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smlt1291 (trbB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sml02044]
    Smlt1291 (trbB)
Enzymes [BR:sml01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Smlt1291 (trbB)
Secretion system [BR:sml02044]
 Type IV secretion system
  Trb secretion system protein
   Smlt1291 (trbB)
SSDB
Motif
Pfam: T2SSE TrwB_AAD_bind FtsK_SpoIIIE Zeta_toxin AAA_28 AAA_16 IstB_IS21 AAA_25 MMR_HSR1 ABC_tran CbiA AAA_7 ATPase MobB AAA_30 TIP49 Sigma54_activat DEAD AAA_10 AAA_29 AAA_19 ResIII TsaE GTP_EFTU CLP1_P
Other DBs
NCBI-ProteinID: CAQ44840
UniProt: B2FTE3
Position
complement(1332892..1333932)
AA seq 346 aa
MNSAPPASSTATSLDRRIQMLRTAMGPLIAAALEDPDVVEIMLNPDRTLWIDRLSSGRAP
MGVELSEADGERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRK
RAFGVIPLSRYIEDGMMTAAQAGLLVRAVRERQNILIAGGTSTGKTTLANALLAEIAATG
DRVLVLEDTVELQCAARDHVPLRTRAGVVSMTELVRSSMRLRPDRVVVGEVRGAEALDLI
KVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRALIAEAVNVVIHIAGRGRKRR
IESIARVIGFDGVGYQLADALEAPFPELLPQSELSSLSPDHSGELP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaattccgcaccgccagcttcttccacggccacctcgctcgaccgccgcatccagatg
ctgcgcaccgccatgggcccgctgatcgccgccgcactcgaagacccggatgtggtggaa
atcatgctcaacccggatcgcaccttgtggatcgaccggctttcatcgggccgcgcaccg
atgggcgtggagctgtccgaagcagacggcgaacgcatcatccggctggtggctgcccac
gtcggcgcggaagtgcatcgcggccagccgttgttgacggccgagctgcccgagacgggc
gaacgcttcgagggcatcttgccgccggctgcgccggggccggccttcgccttgcgcaag
cgcgcctttggcgtgatcccgctgtcgcgctacatcgaggacgggatgatgaccgccgcg
caggccggcctgctggtgcgcgccgtgcgcgagcgccagaacatcctgatcgccggtggg
acgagtaccggcaagaccaccctggccaatgccttgctggccgagatcgccgccaccggc
gaccgcgtgctggtgctcgaagacacggtggagctgcaatgcgcggcccgcgaccacgtg
ccgctgcgcacgcgcgcgggcgtggtgtccatgaccgagctggtgcgttcgtccatgcgc
ctacggccggatcgcgtcgtcgtcggcgaggtacgcggcgccgaggcgctggatctcatc
aaggtctggggcaccggccatccgggcggcatcgccacgatccacgccggctccgcgctg
ggcgcgctgctgcgcctggagcaactgattctcgaagtggcggtgaacccgccccgtgcg
ctgatcgcggaagcggtcaacgtggtcatccacatcgccgggcgcgggcgcaagcgccgc
atcgagagcatcgcccgcgtcatcggcttcgatggcgtgggctaccaactggcggatgcg
ctggaggctccattcccggagttgttgccgcagtccgaactttcctccctgtcccctgac
cactctggagaactgccatga

DBGET integrated database retrieval system