KEGG   Homo sapiens (human): 10890Help
Entry
10890             CDS       T01001                                 

Gene name
RAB10
Definition
(RefSeq) RAB10, member RAS oncogene family
  KO
K07903  Ras-related protein Rab-10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    10890 (RAB10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10890 (RAB10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10890 (RAB10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10890 (RAB10)
   04031 GTP-binding proteins [BR:hsa04031]
    10890 (RAB10)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    10890 (RAB10)
 Protein recycling
  Rab GTPases and associated proteins
    10890 (RAB10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10890 (RAB10)
  Exosomal proteins of other body fluids (saliva and urine)
   10890 (RAB10)
  Exosomal proteins of colorectal cancer cells
   10890 (RAB10)
  Exosomal proteins of bladder cancer cells
   10890 (RAB10)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    10890 (RAB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 AAA_7 TniB DUF3963
Motif
Other DBs
NCBI-GeneID: 10890
NCBI-ProteinID: NP_057215
OMIM: 612672
HGNC: 9759
Ensembl: ENSG00000084733
Vega: OTTHUMG00000094796
Pharos: P61026(Tbio)
UniProt: P61026
Structure
PDB: 

Position
2p23.3
AA seq 200 aa AA seqDB search
MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL
QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL
GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN
SENVDISSGGGVTGWKSKCC
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggggattccggagtg
gggaagacctgcgtcctttttcgtttttcggatgatgccttcaatactacctttatttcc
accataggaatagacttcaagatcaaaacagttgaattacaaggaaagaagatcaagcta
cagatatgggatacagcaggccaggagcgatttcacaccatcacaacctcctactacaga
ggcgcaatgggtatcatgctagtatatgacatcaccaatggtaaaagttttgaaaacatc
agcaaatggcttagaaacatagatgagcatgccaatgaagatgtggaaagaatgttacta
ggaaacaagtgtgatatggacgacaaaagagttgtacctaaaggaaaaggagaacagatt
gcaagggagcatggtattaggttttttgagactagtgcaaaagcaaatataaacatcgaa
aaggcgttcctcacgttagctgaagatatccttcgaaagacccctgtaaaagagcccaac
agtgaaaatgtagatatcagcagtggaggaggcgtgacaggctggaagagcaaatgctgc
tga

DBGET integrated database retrieval system