KEGG   Homo sapiens (human): 5983
Entry
5983              CDS       T01001                                 

Symbol
RFC3, RFC38
Name
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5983 (RFC3)
   03420 Nucleotide excision repair
    5983 (RFC3)
   03430 Mismatch repair
    5983 (RFC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5983 (RFC3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5983 (RFC3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5983 (RFC3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5983 (RFC3)
  DNA Replication Termination Factors
   ELG1-RFC complex
    5983 (RFC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5983 (RFC3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5983 (RFC3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5983 (RFC3)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA Rad17 DNA_pol3_delta AAA_16 Rep_fac_C AAA_22 ABC_tran ATPgrasp_ST DUF2247 CHB_HEX AAA_19 AAA_5 zf-HC2
Other DBs
NCBI-GeneID: 5983
NCBI-ProteinID: NP_002906
OMIM: 600405
HGNC: 9971
Ensembl: ENSG00000133119
Vega: OTTHUMG00000016715
Pharos: P40938(Tbio)
UniProt: P40938 A0A024RDQ8
Position
13q13.2
AA seq 356 aa
MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPF
TADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcctctgggtggacaagtatcggccctgctccttgggacggctggactatcacaag
gagcaggcggcccagctgcggaacctggtgcagtgtggtgactttcctcatctgttagtg
tacggaccatcaggtgctggaaaaaagacaagaattatgtgtattctacgtgaactttat
ggtgttggagtggaaaaattgagaattgaacatcagaccatcacaactccatctaaaaaa
aaaattgaaattagcaccattgcaagtaactaccaccttgaagttaatcctagtgatgct
ggaaatagtgaccgagtagtcattcaggagatgttgaaaacagtggcacaatcacaacaa
cttgaaacaaactctcaaagggattttaaagtggtattattgacagaagttgacaaactc
accaaagatgctcagcatgccttgcgaagaaccatggaaaaatatatgtctacctgcaga
ttgatcttgtgctgcaattctacatctaaagtgatcccacctattcgtagtaggtgcttg
gcggttcgtgtgcctgctcccagcattgaagatatttgccacgtgttatctactgtgtgt
aagaaggaaggtctgaatcttccttcacaactggctcatagacttgcagagaagtcttgt
agaaatctcagaaaagccctgcttatgtgtgaagcctgcagagtgcaacaatatcctttt
actgcagatcaagaaatccctgagacagattgggaggtgtatctgagggagactgcaaat
gctattgtcagtcagcaaactccacaaaggctccttgaagttcgtggaaggctgtatgag
cttctaactcattgtattcctcctgagataataatgaagggccttctctcagaactgtta
cataattgtgatggacaactgaaaggggaggtggcacaaatggcagcttactatgagcat
cgtctacagctgggtagcaaagccatttatcacttggaagcgtttgtggccaaattcatg
gcactttataagaagttcatggaggatggattggaaggcatgatgttctga

KEGG   Homo sapiens (human): 5985
Entry
5985              CDS       T01001                                 

Symbol
RFC5, RFC36
Name
(RefSeq) replication factor C subunit 5
  KO
K10756  replication factor C subunit 3/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5985 (RFC5)
   03420 Nucleotide excision repair
    5985 (RFC5)
   03430 Mismatch repair
    5985 (RFC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5985 (RFC5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5985 (RFC5)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5985 (RFC5)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5985 (RFC5)
  DNA Replication Termination Factors
   ELG1-RFC complex
    5985 (RFC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5985 (RFC5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5985 (RFC5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5985 (RFC5)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_24 AAA_16 AAA_22 AAA_11 AAA_assoc_2 RuvB_N ResIII DUF815 AAA_19 AAA_14 AAA_5 DNA_pol3_delta PhoH DEAD TIP49 TniB AAA_30 AAA_7 T2SSE ATPase_2 IstB_IS21 AAA_25 Mg_chelatase AAA_3 SNF2_N Thioredoxin_6
Other DBs
NCBI-GeneID: 5985
NCBI-ProteinID: NP_031396
OMIM: 600407
HGNC: 9973
Ensembl: ENSG00000111445
Vega: OTTHUMG00000156438
Pharos: P40937(Tbio)
UniProt: P40937
Position
12q24.23
AA seq 340 aa
METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYG
PPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFK
LVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPE
LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTG
HPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIH
LLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagacctcagcactcaagcagcaggagcagcccgcggcgaccaagatcaggaacctg
ccctgggttgaaaaataccggccacagaccctgaatgatctcatttctcatcaggacatt
ctgagtaccattcagaagtttatcaatgaagaccgactgccacacttgcttctctacggt
cccccagggacaggcaagacatctaccatcctagcctgtgcgaaacagctatataaagac
aaagaatttggctccatggtcttggagctgaatgcttcagatgaccgaggaatagacatc
attcgaggaccgatcctgagctttgctagcacaaggacaatatttaagaaaggctttaag
ctagtgatcttggatgaagcagacgccatgactcaggacgcccagaatgccttgagaaga
gtaattgagaaattcacagaaaataccagattctgcctcatctgtaactatctgtcaaag
atcatccctgccttgcagtcccgctgcacgaggtttcggttcggtcccctgactcctgaa
ctcatggttccccgcctggaacatgtcgtggaagaagagaaagttgatataagtgaagat
ggaatgaaagcactagtcactctttccagtggagacatgcgtagggctctgaacattttg
cagagcaccaatatggcctttgggaaggtgacagaggagactgtctacacctgcaccggg
cacccgctcaagtcagacattgccaacatcctggactggatgttgaatcaagatttcacc
acagcctacagaaatattacagagttgaaaactctgaaggggttggcactgcatgatatc
ctgacagagatacacttgtttgtgcatagagttgactttccatcttcagttcgaatacat
ttattgaccaaaatggcagacattgagtacaggctttctgttggcaccaacgagaagatc
cagctgagctccctcattgctgcatttcaagtcaccagagacctgattgttgcagaggcc
tag

DBGET integrated database retrieval system