KEGG   Homo sapiens (human): 7189Help
Entry
7189              CDS       T01001                                 

Gene name
TRAF6, MGC:3310, RNF85
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Module
hsa_M00686  Toll-like receptor signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7189 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7189 (TRAF6)
   04064 NF-kappa B signaling pathway
    7189 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7189 (TRAF6)
   04140 Autophagy - animal
    7189 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7189 (TRAF6)
   04621 NOD-like receptor signaling pathway
    7189 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    7189 (TRAF6)
   04657 IL-17 signaling pathway
    7189 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    7189 (TRAF6)
  09158 Development
   04380 Osteoclast differentiation
    7189 (TRAF6)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7189 (TRAF6)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    7189 (TRAF6)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    7189 (TRAF6)
   05152 Tuberculosis
    7189 (TRAF6)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    7189 (TRAF6)
   05162 Measles
    7189 (TRAF6)
   05160 Hepatitis C
    7189 (TRAF6)
   05168 Herpes simplex infection
    7189 (TRAF6)
   05169 Epstein-Barr virus infection
    7189 (TRAF6)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    7189 (TRAF6)
   05140 Leishmaniasis
    7189 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    7189 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7189 (TRAF6)
   04121 Ubiquitin system [BR:hsa04121]
    7189 (TRAF6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7189 (TRAF6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    7189 (TRAF6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7189 (TRAF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX U-box Tropomyosin_1 zf-RING_11 Spc29 ADIP EzrA UPF0242 DUF16 DM Dynactin_p22 Sina FliJ AAA_13 Filament CENP-F_leu_zip DUF3450 HMMR_N DUF1664 PspA_IM30 Lebercilin
Motif
Other DBs
NCBI-GeneID: 7189
NCBI-ProteinID: NP_004611
OMIM: 602355
HGNC: 12036
Ensembl: ENSG00000175104
Vega: OTTHUMG00000166391
Pharos: Q9Y4K3(Tbio)
UniProt: Q9Y4K3
Structure
PDB: 

Position
11p12
AA seq 522 aa AA seqDB search
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgtaacaaaagatgatagtgtgggtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagagttt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgagaagca
gtgcaaacgccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgagacatcttgaggatcatcaagcacattgtgagtttgctcttatg
gattgtccccaatgccagcgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagccccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agcgttatacccgactctgggtatatctcagaggtccggaatttccaggaaactattcac
cagttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgctaaaatg
gaaactcagagtatgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaatcgaagcacagcagtgcaatggaatttatatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctggattc
tacactggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacaatgcaaggagaatatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaagca
cctgtaaggcaaaaccacgaagagataatggatgccaaaccagagctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaacttttatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgatgca
ggggtatag

DBGET integrated database retrieval system