KEGG   Homo sapiens (human): 7189Help
Entry
7189              CDS       T01001                                 

Gene name
TRAF6, MGC:3310, RNF85
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05133  Pertussis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Module
hsa_M00686  Toll-like receptor signaling
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7189 (TRAF6)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7189 (TRAF6)
   04064 NF-kappa B signaling pathway
    7189 (TRAF6)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7189 (TRAF6)
   04140 Autophagy - animal
    7189 (TRAF6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7189 (TRAF6)
   04621 NOD-like receptor signaling pathway
    7189 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    7189 (TRAF6)
   04657 IL-17 signaling pathway
    7189 (TRAF6)
  Nervous system
   04722 Neurotrophin signaling pathway
    7189 (TRAF6)
  Development
   04380 Osteoclast differentiation
    7189 (TRAF6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7189 (TRAF6)
   05222 Small cell lung cancer
    7189 (TRAF6)
  Infectious diseases
   05133 Pertussis
    7189 (TRAF6)
   05152 Tuberculosis
    7189 (TRAF6)
   05162 Measles
    7189 (TRAF6)
   05160 Hepatitis C
    7189 (TRAF6)
   05168 Herpes simplex infection
    7189 (TRAF6)
   05169 Epstein-Barr virus infection
    7189 (TRAF6)
   05145 Toxoplasmosis
    7189 (TRAF6)
   05140 Leishmaniasis
    7189 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    7189 (TRAF6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7189 (TRAF6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    7189 (TRAF6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7189 (TRAF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX U-box Tropomyosin_1 Spc29 zf-RING_11 EzrA ADIP DUF16 KASH_CCD Dynactin_p22 AAA_13 FliJ Filament CENP-F_leu_zip DUF3450 HMMR_N Sina IncA DUF1664 PspA_IM30 DM Lebercilin
Motif
Other DBs
NCBI-GeneID: 7189
NCBI-ProteinID: NP_004611
OMIM: 602355
HGNC: 12036
Ensembl: ENSG00000175104
Vega: OTTHUMG00000166391
Pharos: Q9Y4K3(Tbio)
UniProt: Q9Y4K3
Structure
PDB: 

Position
11p12
AA seq 522 aa AA seqDB search
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgtaacaaaagatgatagtgtgggtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagagttt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgagaagca
gtgcaaacgccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgagacatcttgaggatcatcaagcacattgtgagtttgctcttatg
gattgtccccaatgccagcgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagccccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agcgttatacccgactctgggtatatctcagaggtccggaatttccaggaaactattcac
cagttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgctaaaatg
gaaactcagagtatgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaatcgaagcacagcagtgcaatggaatttatatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctggattc
tacactggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacaatgcaaggagaatatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaagca
cctgtaaggcaaaaccacgaagagataatggatgccaaaccagagctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaacttttatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgatgca
ggggtatag

DBGET integrated database retrieval system