KEGG   Mus musculus (house mouse): 19325
Entry
19325             CDS       T01002                                 
Symbol
Rab10, AW107754
Name
(RefSeq) RAB10, member RAS oncogene family
  KO
K07903  Ras-related protein Rab-10
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    19325 (Rab10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19325 (Rab10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19325 (Rab10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19325 (Rab10)
   04031 GTP-binding proteins [BR:mmu04031]
    19325 (Rab10)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    19325 (Rab10)
 Protein recycling
  Rab GTPases and associated proteins
    19325 (Rab10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19325 (Rab10)
  Exosomal proteins of other body fluids (saliva and urine)
   19325 (Rab10)
  Exosomal proteins of colorectal cancer cells
   19325 (Rab10)
  Exosomal proteins of bladder cancer cells
   19325 (Rab10)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    19325 (Rab10)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB MMR_HSR1 AAA_7 TniB DUF3963
Other DBs
NCBI-GeneID: 19325
NCBI-ProteinID: NP_057885
MGI: 105066
Ensembl: ENSMUSG00000020671
UniProt: P61027 Q4FJL0
Position
12:complement(3297428..3359969)
AA seq 200 aa
MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL
QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL
GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN
SENVDISSGGGVTGWKSKCC
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggggactcgggagtg
ggcaagacctgcgtcctttttcgtttttcggacgatgccttcaataccacctttatttcc
accataggaatagactttaagatcaaaacagtggaactacaaggaaagaagatcaagcta
cagatatgggacacagcaggccaggagcgatttcacaccatcacaacctcctactacaga
ggagcaatgggcatcatgctagtgtatgacatcaccaacggtaaaagctttgagaacatc
agcaagtggcttagaaacatagatgagcatgccaatgaagatgtggaaagaatgttacta
gggaacaagtgtgacatggacgacaagagagttgtaccgaaaggcaaaggagaacagatt
gcaagggagcatggtattaggttttttgagactagtgcaaaagcaaatataaacatcgaa
aaggcgttcctcacattagctgaagacatcctccgaaagacccctgtaaaagaacccaac
agtgaaaacgtagatatcagcagtggaggaggcgtgacgggctggaagagcaagtgctgc
tga

DBGET integrated database retrieval system