KEGG   Mus musculus (house mouse): 22034
Entry
22034             CDS       T01002                                 
Symbol
Traf6, 2310003F17Rik, AI851288, C630032O20Rik
Name
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04140  Autophagy - animal
mmu04144  Endocytosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04936  Alcoholic liver disease
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    22034 (Traf6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22034 (Traf6)
   04064 NF-kappa B signaling pathway
    22034 (Traf6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    22034 (Traf6)
   04140 Autophagy - animal
    22034 (Traf6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    22034 (Traf6)
   04621 NOD-like receptor signaling pathway
    22034 (Traf6)
   04622 RIG-I-like receptor signaling pathway
    22034 (Traf6)
   04657 IL-17 signaling pathway
    22034 (Traf6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    22034 (Traf6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    22034 (Traf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22034 (Traf6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    22034 (Traf6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22034 (Traf6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    22034 (Traf6)
   05161 Hepatitis B
    22034 (Traf6)
   05160 Hepatitis C
    22034 (Traf6)
   05171 Coronavirus disease - COVID-19
    22034 (Traf6)
   05162 Measles
    22034 (Traf6)
   05168 Herpes simplex virus 1 infection
    22034 (Traf6)
   05169 Epstein-Barr virus infection
    22034 (Traf6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    22034 (Traf6)
   05135 Yersinia infection
    22034 (Traf6)
   05133 Pertussis
    22034 (Traf6)
   05152 Tuberculosis
    22034 (Traf6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    22034 (Traf6)
   05140 Leishmaniasis
    22034 (Traf6)
   05142 Chagas disease
    22034 (Traf6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    22034 (Traf6)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    22034 (Traf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22034 (Traf6)
   04121 Ubiquitin system [BR:mmu04121]
    22034 (Traf6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     22034 (Traf6)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    22034 (Traf6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    22034 (Traf6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-RING_5 SlyX zf-TRAF_2 Tropomyosin_1 DUF4455 PspA_IM30 UPF0242 Sina U-box DUF16 Spc29 Tropomyosin ADIP TMF_DNA_bd PKcGMP_CC
Other DBs
NCBI-GeneID: 22034
NCBI-ProteinID: NP_001290202
MGI: 108072
Ensembl: ENSMUSG00000027164
UniProt: P70196
Position
2:101508765..101532013
AA seq 530 aa
MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIE
DCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPI
PCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPED
PNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGI
YIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVH
TMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFG
YVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagtctcttaaactgtgagaacagctgcgggtccagccagtcgtccagtgactgctgc
gctgccatggccgcctcctgcagcgctgcagtgaaagatgacagcgtgagtggctctgcc
agcaccgggaacctctccagctccttcatggaggagatccagggctacgatgtggagttt
gacccacctctggagagcaagtatgagtgtcccatctgcttgatggctttacgggaagca
gtgcaaacaccatgtggccacaggttctgcaaagcctgcatcatcaaatccataagggat
gcagggcacaagtgcccagttgacaatgaaatactgctggaaaatcaactgtttcccgac
aattttgcaaagcgagagattctttccctgacggtaaagtgcccaaataaaggctgtttg
caaaagatggaactgagacatctcgaggatcatcaagtacattgtgaatttgctctagtg
aattgtccccagtgccaacgtcctttccagaagtgccaggttaatacacacattattgag
gattgtcccaggaggcaggtttcttgtgtaaactgtgctgtgtccatggcatatgaagag
aaagagatccatgatcaaagctgtcctctggcaaatatcatctgtgaatactgtggtaca
atcctcatcagagaacagatgcctaatcattatgatctggactgcccaacagctccaatc
ccttgcacattcagtgtttttggctgtcatgaaaagatgcagaggaatcacttggcacga
cacttgcaagagaatacccagttgcacatgagactgttggcccaggctgttcataatgtt
aaccttgctttgcgtccgtgcgatgccgcctctccatcccggggatgtcgtccagaggac
ccaaattatgaggaaactatcaaacagttggagagtcgcctagtaagacaggaccatcag
atccgggagctgactgccaaaatggaaactcagagtatgtacgtgggcgagctcaaacgg
accattcggaccctggaggacaaggttgccgaaatggaagcacagcagtgtaacgggatc
tacatttggaagattggcaactttgggatgcacttgaaatcccaagaagaggaaagacct
gttgtcatccatagccctggattctacacaggcagacctgggtacaagctgtgcatgcgc
ctgcatcttcagttaccgacagctcagcgctgtgcaaactatatatccctttttgtccac
acaatgcaaggagaatatgacagccacctcccctggcccttccagggtacaatacgcctt
acaattctcgaccagtctgaagcacttataaggcaaaaccacgaagaggtcatggacgcc
aaaccagaactgcttgcctttcagcgacccacaatcccacggaaccccaaaggttttggc
tatgtaacatttatgcacctggaagccttaagacagggaaccttcattaaggatgataca
ttactagtgcgctgtgaagtctctacccgctttgacatgggtggccttcggaaggagggt
ttccagccacgaagtactgatgcgggggtgtag

DBGET integrated database retrieval system