KEGG   Mus musculus (mouse): 74254
Entry
74254             CDS       T01002                                 

Gene name
Gpn1, 2410004J02Rik, AI449615, MBDIN, NTPBP, Xab1
Definition
(RefSeq) GPN-loop GTPase 1
  KO
K24104  GPN-loop GTPase
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    74254 (Gpn1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     74254 (Gpn1)
SSDB
Motif
Pfam: ATP_bind_1 GTP_EFTU MMR_HSR1 FeoB_N cobW AAA_16 MeaB CLP1_P AAA_24 G-alpha SRP54 SRPRB NTPase_1 Arf AAA_33 NACHT AAA_22 MobB Viral_helicase1 AAA_31 Ras KAP_NTPase DUF87 AAA_18 PduV-EutP AAA_7 SCP_3 TsaE AAA_30 AAA_19 NB-ARC PRK AAA_5
Other DBs
NCBI-GeneID: 74254
NCBI-ProteinID: NP_598517
MGI: 1921504
Ensembl: ENSMUSG00000064037
Vega: OTTMUSG00000028269
UniProt: Q8VCE2 Q4VAB2
Position
5; 5 B1
AA seq 372 aa
MAAPVAPSEPQASRAPQPPVCLLVLGMAGSGKTTFVQRLTGHLHNKGCPPYVINLDPAVH
EVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNTFRYVL
IDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKT
KLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRV
VGVSAVVGTGFDELCTQVTSAAEEYEREYRPEYERLKKSLANAQSNQQKEQLERLRKDMG
SVALDPEAGKGNASPVLDPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESREEPAFQNF
MEESMAHWKRNK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcggcgcccgtggctccatccgaaccccaggcttcccgggctcctcagccccccgtg
tgtctgttggtgttgggaatggcgggatccgggaaaactacctttgtacagaggctcaca
ggacacctgcacaacaaaggctgtccaccgtatgtaatcaacctggacccagctgtgcat
gaagtcccctttcccgccaatattgatatccgagacacagtgaaatataaagaagtcatg
aagcaatatggacttgggccaaacggaggtatagtgacctcactcaacctctttgctacc
agatttgatcaggtgatgaaatttattgagaaggcccagaacacattcagatatgtcttg
attgacacacctggacagattgaagtatttacctggtcagcttcagggacaatcatcact
gaggccctggcttcctcatttccaacagtagtcatctatgtcatggatacatcacggagc
actaacccagtgaccttcatgtccaatatgctttacgcatgcagcatcttgtacaaaacc
aagctgcctttcattgtggtcatgaacaaaaccgacatcattgaccacagctttgccgtg
gagtggatgcaggattttgaggctttccaggatgccttgaaccaagagactacctacgtc
agtaacctgactcgttccatgagcctggtgttggatgagttctacagctcactcagggtg
gtgggtgtgtctgctgtggtgggcaccggcttcgatgaactctgtactcaggtcaccagt
gctgcagaggagtacgaaagggaatatcgtcctgaatacgagcgtctgaagaaatcactg
gcaaatgcccagagtaatcagcagaaggagcaactggagcgtcttcggaaggatatgggc
tccgtagccctggatccagaggccggcaaaggcaacgcatctcctgtgctggatccttct
gacttgatcctgactcgaggaaccttggatgaggaggatgaagaagctgacagtgacacg
gatgacattgaccacagagttacagaggaaagccgtgaagagccagcatttcagaacttc
atggaggagtcaatggcacactggaagaggaacaagtag

DBGET integrated database retrieval system