KEGG   Mus musculus (house mouse): 74254
Entry
74254             CDS       T01002                                 
Symbol
Gpn1, 2410004J02Rik, MBDIN, NTPBP, Xab1
Name
(RefSeq) GPN-loop GTPase 1
  KO
K24104  GPN-loop GTPase
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    74254 (Gpn1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     74254 (Gpn1)
SSDB
Motif
Pfam: ATP_bind_1 GTP_EFTU FeoB_N MeaB MMR_HSR1 AAA_16 cobW CLP1_P AAA_24 SRP54 G-alpha AAA_22 Arf NTPase_1 AAA_33 NACHT Viral_helicase1 MobB AAA_18 DO-GTPase1 AAA_30 DUF87 nSTAND3 KAP_NTPase TsaE AAA_5 PRK AAA_7 NB-ARC ABC_tran SCP_3 APS_kinase LpxK
Other DBs
NCBI-GeneID: 74254
NCBI-ProteinID: NP_598517
MGI: 1921504
Ensembl: ENSMUSG00000064037
UniProt: Q8VCE2 Q4VAB2
Position
5:31652085..31670250
AA seq 372 aa
MAAPVAPSEPQASRAPQPPVCLLVLGMAGSGKTTFVQRLTGHLHNKGCPPYVINLDPAVH
EVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNTFRYVL
IDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKT
KLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRV
VGVSAVVGTGFDELCTQVTSAAEEYEREYRPEYERLKKSLANAQSNQQKEQLERLRKDMG
SVALDPEAGKGNASPVLDPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESREEPAFQNF
MEESMAHWKRNK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcggcgcccgtggctccatccgaaccccaggcttcccgggctcctcagccccccgtg
tgtctgttggtgttgggaatggcgggatccgggaaaactacctttgtacagaggctcaca
ggacacctgcacaacaaaggctgtccaccgtatgtaatcaacctggacccagctgtgcat
gaagtcccctttcccgccaatattgatatccgagacacagtgaaatataaagaagtcatg
aagcaatatggacttgggccaaacggaggtatagtgacctcactcaacctctttgctacc
agatttgatcaggtgatgaaatttattgagaaggcccagaacacattcagatatgtcttg
attgacacacctggacagattgaagtatttacctggtcagcttcagggacaatcatcact
gaggccctggcttcctcatttccaacagtagtcatctatgtcatggatacatcacggagc
actaacccagtgaccttcatgtccaatatgctttacgcatgcagcatcttgtacaaaacc
aagctgcctttcattgtggtcatgaacaaaaccgacatcattgaccacagctttgccgtg
gagtggatgcaggattttgaggctttccaggatgccttgaaccaagagactacctacgtc
agtaacctgactcgttccatgagcctggtgttggatgagttctacagctcactcagggtg
gtgggtgtgtctgctgtggtgggcaccggcttcgatgaactctgtactcaggtcaccagt
gctgcagaggagtacgaaagggaatatcgtcctgaatacgagcgtctgaagaaatcactg
gcaaatgcccagagtaatcagcagaaggagcaactggagcgtcttcggaaggatatgggc
tccgtagccctggatccagaggccggcaaaggcaacgcatctcctgtgctggatccttct
gacttgatcctgactcgaggaaccttggatgaggaggatgaagaagctgacagtgacacg
gatgacattgaccacagagttacagaggaaagccgtgaagagccagcatttcagaacttc
atggaggagtcaatggcacactggaagaggaacaagtag

DBGET integrated database retrieval system