KEGG   Phenylobacterium zucineum: PHZ_c2356
Entry
PHZ_c2356         CDS       T00750                                 

Definition
(GenBank) virB11 type IV secretion protein
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PHZ_c2356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pzu02044]
    PHZ_c2356
Enzymes [BR:pzu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PHZ_c2356
Secretion system [BR:pzu02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   PHZ_c2356
SSDB
Motif
Pfam: T2SSE AAA_16 ABC_tran AAA_29 Mg_chelatase AAA_22 AAA_28 AAA_2 AAA_18 AAA_33 Viral_helicase1 TrwB_AAD_bind FtsK_SpoIIIE Zeta_toxin TsaE NACHT AAA_7 IstB_IS21 DUF87 MukB Sigma54_activat AAA_5 AAA_24 cobW PduV-EutP MMR_HSR1 dNK Guanylate_kin AAA_23 DEAD DUF2075
Other DBs
NCBI-ProteinID: ACG78766
UniProt: B4RFV3
Position
2668046..2669038
AA seq 330 aa
MGDVAILNHHLRPLRAALDADGTTELVVNRPGEFAVERRGAWLWHEAPELTTEWLRTLAI
GAAAATAQDVSPDRPICSTVLPSGERCQIVLPPAAEHPSLTLRRPSPTAFELADLARSGL
FENVATAPDDEADAAMRALQAAGDWPGFFGRAVRARRNIVVSGATGSGKTTLAKALLRLI
PPDERLITVEDAREFITPHRNVVHLLYSKDGQGLAKVGPKALLESALRMRPDRILLQELR
DESAFFYLRNVNSGHPGSITTVHADSASLAFEQLTLLIKESEGGRHLAREDIRGMLRMLV
DVVVHVVRRGERFGVREIWYDPELKRTLAA
NT seq 993 nt   +upstreamnt  +downstreamnt
atgggcgacgtggcgatcctcaatcaccacctccgccctttgcgagctgcgctcgacgcc
gacgggacgacagagcttgtggtcaatcgaccaggcgagtttgcggtggagcgccgcggc
gcctggttgtggcatgaggcgccggagctgacgaccgagtggctgcgcactctggcgatc
ggggcggccgcagcgacggcccaggatgtcagccccgaccgtccgatctgctccaccgtc
cttccgtccggcgagcgctgccagatcgtcctgccacccgcagcagagcacccctcgctc
acactgagacgcccctcgccaacagcctttgaactcgcggacctggcccggtcagggttg
ttcgagaacgtcgccaccgccccggacgacgaggcagatgcggccatgcgcgccctgcag
gccgctggagactggcccggcttcttcggccgcgccgtccgcgcgcgtcgaaacatcgtc
gtgagcggagcgaccggctccggcaagacaacgctcgccaaggcgctactccgcctgatc
cctccggatgagcggttgatcacggtggaggacgcccgcgaattcatcaccccgcaccga
aacgtcgtccacctgctctactcgaaggacggacagggcctcgcgaaggtgggcccgaag
gctctcctggaaagcgcgctgcgcatgcgacccgaccgcatccttcttcaggagctgcgc
gacgaaagcgccttcttctatctgcgcaacgtcaactcaggtcatcccggctcgatcacc
accgtccatgccgactccgcgagcctcgccttcgagcagctgaccctgctcatcaaggag
agcgaaggcggccgtcacctggctcgtgaggacatccggggcatgctccgcatgctggtc
gatgtggtggttcacgtcgtccgcagaggtgagcgcttcggggttcgcgagatctggtat
gatcccgagctcaagcgcaccctcgccgcttag

DBGET integrated database retrieval system