KEGG   Rattus norvegicus (rat): 117103
Entry
117103            CDS       T01003                                 

Gene name
Rab8a
Definition
(RefSeq) ras-related protein Rab-8A
  KO
K07901  Ras-related protein Rab-8A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04144  Endocytosis
rno04152  AMPK signaling pathway
rno04530  Tight junction
rno04972  Pancreatic secretion
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    117103 (Rab8a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    117103 (Rab8a)
   04140 Autophagy - animal
    117103 (Rab8a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    117103 (Rab8a)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    117103 (Rab8a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    117103 (Rab8a)
   05022 Pathways of neurodegeneration - multiple diseases
    117103 (Rab8a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    117103 (Rab8a)
   03036 Chromosome and associated proteins [BR:rno03036]
    117103 (Rab8a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    117103 (Rab8a)
   04031 GTP-binding proteins [BR:rno04031]
    117103 (Rab8a)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    117103 (Rab8a)
 Autophagy
  Other autophagy associated proteins
    117103 (Rab8a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    117103 (Rab8a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117103 (Rab8a)
  Exosomal proteins of other body fluids (saliva and urine)
   117103 (Rab8a)
  Exosomal proteins of colorectal cancer cells
   117103 (Rab8a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    117103 (Rab8a)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 Phage_holin_6_1 AAA_16
Other DBs
NCBI-GeneID: 117103
NCBI-ProteinID: NP_446450
RGD: 621144
Ensembl: ENSRNOG00000014621
UniProt: P35280 F8V328
Position
16
AA seq 207 aa
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSSHGVKITVEQQKRTSFFRCSLL
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtaggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaattccacgttcatctctacc
ataggaattgactttaaaattaggaccatagagctcgatggcaagaggattaaactgcag
atatgggacacagccggccaggagcggtttcggacaatcacgacagcctactacaggggt
gccatgggtatcatgctggtctacgacattaccaatgagaagtccttcgacaacatccgg
aattggattcggaacattgaggagcatgcctctgcagatgtggagaagatgatactgggg
aataagtgtgatgtgaacgacaagaggcaggtgtccaaggaacggggagaaaagctggca
ctcgactatgggatcaagttcatggagaccagcgcgaaggccaacatcaatgtggagaac
gcatttttcactctcgccagggatatcaaagcaaaaatggacaaaaaattggaagggaac
agcccacaggggagcagccatggagtcaagatcacagtggagcagcagaagaggaccagc
ttcttccggtgcagtctcctgtga

DBGET integrated database retrieval system