KEGG   Rattus norvegicus (rat): 266688
Entry
266688            CDS       T01003                                 

Gene name
Rab8b
Definition
(RefSeq) ras-related protein Rab-8B
  KO
K07902  Ras-related protein Rab-8B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    266688 (Rab8b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    266688 (Rab8b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    266688 (Rab8b)
   04031 GTP-binding proteins [BR:rno04031]
    266688 (Rab8b)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    266688 (Rab8b)
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    266688 (Rab8b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   266688 (Rab8b)
  Exosomal proteins of other body fluids (saliva and urine)
   266688 (Rab8b)
  Exosomal proteins of colorectal cancer cells
   266688 (Rab8b)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    266688 (Rab8b)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB RsgA_GTPase GTP_EFTU MMR_HSR1 DUF3963 Septin PduV-EutP AAA_16 AAA_7
Other DBs
NCBI-GeneID: 266688
NCBI-ProteinID: NP_695229
RGD: 628764
Ensembl: ENSRNOG00000018009
UniProt: P70550 B0BMV5
Position
8
AA seq 207 aa
MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILG
NKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDS
NSSGAGGPVKITESRSKKTSFFRCSLL
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgaagacgtacgattatctgttcaagctgctgctcatcggcgactccggcgttggc
aagacctgcctcctgttccgcttctcagaggacgccttcaacaccacctttatctccacc
atcggaattgattttaaaatcagaacgatagaactcgacggaaagaaaattaaacttcag
atatgggacacggcgggccaggaaagattccgaacaattacaacagcatactatagagga
gccatgggaattatgctggtctatgacatcaccaatgaaaaatcctttgacaatattaaa
aattggataagaaacattgaagagcatgcctcttcagatgttgaaagaatgatcctgggt
aacaaatgtgatatgaacgacaaaagacaagtgtcgaaagaaagaggggagaagttagca
attgactatgggattaaatttttggagacaagtgcaaaatcgagtacaaatgtagaagag
gcattttttacacttgcacgggatataatgacaaaactcaacagaaaaatgaatgacagc
aattcatcaggagcaggtgggccagtgaaaataacagaaagccggtctaagaagaccagt
ttcttccggtgttctctgctttga

DBGET integrated database retrieval system