KEGG   Rattus norvegicus (rat): 311245
Entry
311245            CDS       T01003                                 

Gene name
Traf6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04140  Autophagy - animal
rno04144  Endocytosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04722  Neurotrophin signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    311245 (Traf6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    311245 (Traf6)
   04064 NF-kappa B signaling pathway
    311245 (Traf6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    311245 (Traf6)
   04140 Autophagy - animal
    311245 (Traf6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    311245 (Traf6)
   04621 NOD-like receptor signaling pathway
    311245 (Traf6)
   04622 RIG-I-like receptor signaling pathway
    311245 (Traf6)
   04657 IL-17 signaling pathway
    311245 (Traf6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    311245 (Traf6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    311245 (Traf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    311245 (Traf6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    311245 (Traf6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    311245 (Traf6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    311245 (Traf6)
   05161 Hepatitis B
    311245 (Traf6)
   05160 Hepatitis C
    311245 (Traf6)
   05171 Coronavirus disease - COVID-19
    311245 (Traf6)
   05162 Measles
    311245 (Traf6)
   05168 Herpes simplex virus 1 infection
    311245 (Traf6)
   05169 Epstein-Barr virus infection
    311245 (Traf6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    311245 (Traf6)
   05135 Yersinia infection
    311245 (Traf6)
   05133 Pertussis
    311245 (Traf6)
   05152 Tuberculosis
    311245 (Traf6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    311245 (Traf6)
   05140 Leishmaniasis
    311245 (Traf6)
   05142 Chagas disease
    311245 (Traf6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    311245 (Traf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311245 (Traf6)
   04121 Ubiquitin system [BR:rno04121]
    311245 (Traf6)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     311245 (Traf6)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    311245 (Traf6)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    311245 (Traf6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX DUF4455 Tropomyosin_1 PspA_IM30 U-box UPF0242 zf-RING_11 DUF16 Spc29 Filament EzrA TACC_C Phage_GP20 TMF_DNA_bd ADIP Sina
Other DBs
NCBI-GeneID: 311245
NCBI-ProteinID: NP_001101224
RGD: 1306853
Ensembl: ENSRNOG00000004639
UniProt: B5DF45
Position
3
AA seq 530 aa
MSLLNCENSCASSQSSSDCCAAMANSCSAAMKDDSVSGCVSTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNKGCVQKMELRHLEDHQVHCEFALVICPQCQRFFQKCQINKHIIE
DCPRRQVSCVNCAVPMPYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPV
PCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLSLRPCDASSPSRGCRPED
PNYEETVKQLEGRLVRQDHQIRELTAKMETQSMHVSELKRTIRSLEDKVAEMEAQQCNGI
YIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVH
TMQGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRNPKGFG
YVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagtctcttaaactgtgaaaacagctgtgcgtccagccagtcttcaagcgactgctgt
gctgccatggccaactcctgcagtgctgccatgaaagatgacagtgtgagtggctgtgtc
agcacggggaacctgtccagctccttcatggaggagatccagggatatgatgtggagttt
gacccacctttggaaagcaagtatgagtgccccatctgcttgatggctttacgggaagca
gtgcaaacaccatgtggccacaggttctgcaaagcctgcatcaccaagtccataagggat
gcaggtcacaagtgcccagttgacaatgaaatactgctggaaaatcaactgtttcctgac
aattttgcaaagcgagagattctttccctgacggtaaagtgtccaaataaaggctgtgtg
caaaagatggagctgagacatctcgaggatcatcaagtacattgtgaattcgctctagtg
atttgtccccaatgccaacgttttttccaaaagtgccagattaataaacacattatcgag
gattgtcccaggagacaggtttcttgtgtaaactgtgctgtgcccatgccgtatgaagag
aaagagatccacgatcaaagctgtcctctggcaaatatcatctgtgaatactgtggtaca
atcctcataagagaacagatgcctaatcattatgatctagactgcccaacagctccagtc
ccctgcacattcagtgtgtttggctgtcacgaaaagatgcagaggaatcacttggcacgg
cacttgcaagagaacacccagttgcacatgagactgttggcccaggctgttcataatgtt
aacctctctttgcggccatgcgatgcctcctctccatcccggggatgtcgtcctgaggac
ccaaattatgaggaaacggtcaaacagttggaggggcgcctagtaagacaggaccatcaa
atccgggagctgaccgccaaaatggaaacgcagagcatgcatgtgagcgagctcaagcgg
accattcgaagcctcgaggacaaagttgccgagatggaagcacagcagtgtaatggcatt
tacatttggaagattggcaactttgggatgcacttgaaatcccaagaagaggaaagacct
gtggtcattcatagccctggattctacacaggcagacctgggtacaagctgtgcatgcgc
ctgcacctccagctaccgacggctcagcgctgtgcaaactacatttccctctttgtccac
acaatgcaaggagagtatgacagccacctcccctggcccttccagggtacaatacgcctc
acgatccttgatcagtctgaagcagtaataaggcaaaaccacgaagaggtcatggatgct
aagccagaactgcttgcctttcagcggcccaccatcccacggaaccccaaaggttttggc
tatgtgacattcatgcacctggaagccttaagacagggaaccttcatcaaggatgatacg
ttattagtgcgctgtgaagtctctacccgctttgacatggggggccttcggaaggagggg
ttccagccacggagtactgatgcaggcgtgtag

DBGET integrated database retrieval system