KEGG   Sinorhizobium meliloti 1021: SMa1302
Entry
SMa1302           CDS       T00058                                 
Symbol
virB11
Name
(GenBank) VirB11-like ATPase
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMa1302 (virB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sme02044]
    SMa1302 (virB11)
Enzymes [BR:sme01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SMa1302 (virB11)
Secretion system [BR:sme02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   SMa1302 (virB11)
SSDB
Motif
Pfam: T2SSE nSTAND3 ResIII AAA_16 AAA_22 AAA_14 Zeta_toxin DEAD AAA_18 Guanylate_kin AAA_28 AAA_29 Sigma54_activat Mg_chelatase FtsK_SpoIIIE AAA_7 TsaE ABC_tran TrwB_AAD_bind cobW Viral_helicase1 AAA_19 PduV-EutP ATPase AAA_23 RNA_helicase ATP_bind_1 NB-ARC NACHT TIP49 DUF87 P-loop_TraG AAA_30 dNK
Other DBs
NCBI-ProteinID: AAK65367
RhizoBase: SMa1302
UniProt: Q92Z03
Position
pSymA:complement(711238..712227)
AA seq 329 aa
MTEGADATVVRELLSPFAPFLGDRSLYEVIVNRPGQVLTEGAGGWRTYDLPELSFEKLMR
LARAVASFSHQSIDETRPILSATLPGDERIQIVIPPATTRNTVSITIRKPSSVTFTLNDL
KEREFFSETRSANDGASTRDDGLLALYRAGRFKEFLRHAVISRKNIIISGATGSGKTTLS
KALIKHIPEHERIISIEDTPELIIPQPNHVRLFYSKGAQGLSGAGPKELLESCLRMRPDR
ILLQELRDGTAFYYVRNVNSGHPGSITTVHADSAKLAFQQLTLLVKESAGGRNLDRDDID
KLLKVSIDVIVQCKRIDGRFRATEIYVRA
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaccgaaggtgccgacgcaacggtcgttcgtgaactgctctctccgttcgcgccgttc
ctcggtgacaggtcgctctacgaagtgatcgtaaaccggcccgggcaagtgctgacggaa
ggcgctggtggttggcggacctatgacctgccggagctttccttcgagaagctgatgcgc
cttgcccgggcagttgccagtttttcccaccaatcaattgatgaaacgcgaccgatccta
tcggcaaccctgcccggggacgaacgcatccagatcgtcatcccgccagccaccaccagg
aacacggtcagcatcaccatccgcaagccatcgtcggtcacattcaccctcaatgatctg
aaagagagagagtttttctcagagacgcgatcggccaacgacggcgcctcgacccgggac
gacggcttgctggcgctttaccgtgccggccgcttcaaggaatttttgcggcacgccgtc
atttcacggaagaacatcatcatctcaggcgcaaccggttcgggcaagacgactctctcg
aaagcgctgattaaacacattcccgagcatgagcggatcatttcgatcgaggacacaccc
gaactcattattccgcagcccaaccacgtgcgcctattctattcgaagggtgcccaggga
ctctcgggggctggccccaaagagctgctcgaatcctgtctccggatgcggccggaccga
attttgctgcaggaactgcgcgatggcacggcattctactacgttcgcaacgtcaactcc
ggtcaccccggatcgataactaccgtgcatgccgattctgccaaactcgccttccaacag
ttaacgcttctcgtgaaggaatcggcagggggacggaatctggaccgtgatgacatcgat
aaattactgaaggtatcaatcgacgtaattgttcaatgcaagcgaatagatgggcgattt
cgtgcaacagaaatctacgttcgagcctaa

DBGET integrated database retrieval system