KEGG   Sus scrofa (pig): 100511006Help
Entry
100511006         CDS       T01009                                 

Gene name
RAB8A
Definition
(RefSeq) ras-related protein Rab-8A
  KO
K07901  Ras-related protein Rab-8A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04140  Autophagy - animal
ssc04144  Endocytosis
ssc04152  AMPK signaling pathway
ssc04530  Tight junction
ssc04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100511006 (RAB8A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100511006 (RAB8A)
   04140 Autophagy - animal
    100511006 (RAB8A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100511006 (RAB8A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100511006 (RAB8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100511006 (RAB8A)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100511006 (RAB8A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100511006 (RAB8A)
   04031 GTP-binding proteins [BR:ssc04031]
    100511006 (RAB8A)
Membrane trafficking [BR:ssc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    100511006 (RAB8A)
 Autophagy
  Other autophagy associated proteins
    100511006 (RAB8A)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100511006 (RAB8A)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100511006 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   100511006 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   100511006 (RAB8A)
GTP-binding proteins [BR:ssc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    100511006 (RAB8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 AAA_16
Motif
Other DBs
NCBI-GeneID: 100511006
NCBI-ProteinID: NP_001230731
Ensembl: ENSSSCG00000013848
UniProt: A0A4X1UZR3
Position
2
AA seq 207 aa AA seqDB search
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITPDQQKRSSFFRCVLL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc
ataggaattgactttaaaattaggaccatagagcttgatggcaagagaattaaactacag
atatgggacacagctggtcaggaacggtttcggacgatcacaaccgcctactacaggggc
gcaatgggcatcatgctggtttacgacatcaccaacgagaagtcctttgacaacatccgg
aactggattcgaaacattgaggagcatgcgtctgcagacgtcgaaaagatgatacttggg
aacaagtgcgacgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc
ctggactatggaatcaagttcatggagaccagcgcgaaggccaacatcaacgtggagaac
gcctttttcactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac
agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc
tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system