KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_pTet0039
Entry
CJJ81176_pTet0039 CDS       T00461                                 

Definition
(GenBank) cmgB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cjj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CJJ81176_pTet0039
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cjj02044]
    CJJ81176_pTet0039
Enzymes [BR:cjj01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     CJJ81176_pTet0039
Secretion system [BR:cjj02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   CJJ81176_pTet0039
SSDB
Motif
Pfam: T2SSE ABC_tran FtsK_SpoIIIE AAA_7 AAA_22 TsaE AAA_24 DEAD AAA_10 NACHT Septin ATPase_2 AAA_29 AAA_14 Sigma54_activat ResIII TrwB_AAD_bind DUF87 Pox_A32 RNA_helicase ATP_bind_1 PRK Zeta_toxin AAA_16 GvpD MobB Microtub_bd cobW AAA_23
Other DBs
NCBI-ProteinID: EAQ71800
UniProt: A0A0H3P9F8
Position
pTet:31246..32238
AA seq 330 aa
MSITLDKYTQKFFGEFLKDDNINEICYNGDNKIWVQNSKGLWECIDTKLDFEQAGHFATA
SASFKKDKIDVSRPILSCILVGGERMQIVIPPATKSEHISITIRKPSKTRFKMEDHIKSG
LFEDLNPDDKNKIKPSDEELIKLYEARDYQNFISKAVSYGKNIIIAGETGSGKTTFMKTL
IDFISLDDRIITIEDVEEIKFYEHKNFVQLFYPSEAKSTDFLNSATLLKSCLRMKPDRIL
LAELRGAETYDFINVLASGHGGSITSCHAGSPEETFTRLALMTLQNPQGQCVPFEIIQKT
LKDLIDIVVHIHAHHGKRRISGIYFKEMER
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtcaataacgctagataaatatactcaaaaattttttggagaatttttaaaagatgat
aatatcaatgaaatctgctataacggcgataataaaatttgggtacaaaactctaaagga
ttatgggaatgtatagatactaaacttgattttgaacaagctggacattttgcaactgct
tcagcctcattcaaaaaagataaaatagatgtatcacgccctattcttagttgtattcta
gtaggtggagagcgtatgcaaattgttattcctcctgctacaaaaagcgaacacatttca
attactattagaaagccaagcaaaactcgctttaaaatggaagatcatattaaaagcgga
ctttttgaagatttaaatcctgatgataagaataaaatcaaaccaagcgatgaagaatta
atcaagctatatgaagcaagagattatcaaaattttatatccaaagctgttagctatggt
aaaaatattattatcgctggtgaaacaggaagcggtaaaactacctttatgaaaactctt
attgattttataagccttgatgataggattatcacaatagaagatgttgaagaaatcaaa
ttctatgaacacaaaaatttcgtgcaattattctatcctagcgaagcaaaaagtacagat
tttttaaattctgcaacacttttaaaatcttgtttaagaatgaagcctgataggatttta
ctagcagagcttagaggtgctgaaacttatgattttattaatgttttagctagtggtcat
ggtggaagtatcacaagttgccatgcaggaagccccgaagaaacatttacacgacttgct
ttaatgactctacaaaatccacaaggtcaatgcgtgccttttgaaattatccaaaaaaca
cttaaagacttaatagatattgtcgtgcatatccatgcccatcatggaaaaaggcgtatt
agcggcatttattttaaagaaatggagagataa

DBGET integrated database retrieval system