KEGG   Viruses: 1489680Help
Entry
1489680           CDS       T40000                                 

Gene name
orf1ab, sars1
Definition
(RefSeq) Severe acute respiratory syndrome-related coronavirus; orf1ab polyprotein (pp1ab)
Taxonomy
TAX:694009 [GN:T40069]
  Lineage
Viruses; ssRNA viruses; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus
Taxonomy
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB OrthologParalogGFIT
Motif
Pfam: NSP11 Corona_RPol_N NSP16 Viral_protease Peptidase_C30 SUD-M nsp8 Nsp1 NSP10 nsp9 Nsp3_PL2pro NAR DUF3655 Corona_NSP4_C nsp7 Macro AAA_11 AAA_12 AAA_30 Viral_helicase1 UvrD_C_2 AAA_19 T3SSipB
Motif
Other DBs
NCBI-GeneID: 1489680
NCBI-ProteinID: NP_828849
RS: NC_004718
UniProt: J9T571 A7J8L2
Structure
PDB: 

Position
NC_004718:join(265..13398,13398..21485)
AA seq 7073 aa AA seqDB search
MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGV
LPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRN
VLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGG
AVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAW
FTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI
RSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYL
PTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKR
AYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASF
SASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQA
AGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAY
VTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIV
KGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQC
IRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVG
TPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNV
RITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE
WSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGL
PLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKC
VDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGS
CLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSL
QVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQK
PVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAP
YMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKT
ALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQR
KYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAAR
CMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELG
VEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQL
VDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFL
GRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRAR
AGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLT
GVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLC
ANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYK
LDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQ
MTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTF
KPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIE
CDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIA
THGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFT
KSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSL
ICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPA
LETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSW
LMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVEC
TTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINP
TDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVF
DGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFS
VPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDL
EVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSE
QLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLA
ALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGG
SYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLI
EYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQ
FPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDA
MNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANAL
LFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAI
YVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQ
YNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQ
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR
KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNG
SPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGK
FYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE
PLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
SGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAA
CAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCV
MYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSN
YSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRY
FRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMS
DVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG
AVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKS
LNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND
ALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVD
ADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTAC
TDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGP
KVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDY
LASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFC
DLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNRV
CGVSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEKDEEGNLLDSYFV
VKRHTMSNYQHEETIYNLVKDCPAVAVHDFFKFRVDGDMVPHISRQRLTKYTMADLVYAL
RHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQSLLKTVQ
FCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPIVDSYYSLLMPILTLTRAL
AAESHMDADLAKPLIKWDLLKYDFTEERLCLFDRYFKYWDQTYHPNCINCLDDRCILHCA
NFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKEL
LVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKE
GSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINAN
QVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAK
NRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVET
PHLMGWDYPKCDRAMPNMLRIMASLVLARKHNTCCNLSHRFYRLANECAQVLSEMVMCGG
SLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECL
YRNRDVDHEFVDEFYAYLRKHFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYYQNN
VFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTD
GTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDN
TSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSH
KLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVG
SDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLS
DRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKL
NVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYST
LQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARAR
VECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYI
GDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDN
KLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQN
AVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKIGILCIMSDR
DLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGL
CVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR
DAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLP
WNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFS
TSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTR
CLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAI
KCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIV
CRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQ
VVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYN
LWNTFTRLQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPV
NVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKP
TESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGES
VKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYA
FEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCV
CSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQASQAW
QPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNM
RVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWD
LIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMG
HFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLF
DMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN
NT seq 21222 nt NT seq  +upstreamnt  +downstreamnt
atggagagccttgttcttggtgtcaacgagaaaacacacgtccaactcagtttgcctgtc
cttcaggttagagacgtgctagtgcgtggcttcggggactctgtggaagaggccctatcg
gaggcacgtgaacacctcaaaaatggcacttgtggtctagtagagctggaaaaaggcgta
ctgccccagcttgaacagccctatgtgttcattaaacgttctgatgccttaagcaccaat
cacggccacaaggtcgttgagctggttgcagaaatggacggcattcagtacggtcgtagc
ggtataacactgggagtactcgtgccacatgtgggcgaaaccccaattgcataccgcaat
gttcttcttcgtaagaacggtaataagggagccggtggtcatagctatggcatcgatcta
aagtcttatgacttaggtgacgagcttggcactgatcccattgaagattatgaacaaaac
tggaacactaagcatggcagtggtgcactccgtgaactcactcgtgagctcaatggaggt
gcagtcactcgctatgtcgacaacaatttctgtggcccagatgggtaccctcttgattgc
atcaaagattttctcgcacgcgcgggcaagtcaatgtgcactctttccgaacaacttgat
tacatcgagtcgaagagaggtgtctactgctgccgtgaccatgagcatgaaattgcctgg
ttcactgagcgctctgataagagctacgagcaccagacacccttcgaaattaagagtgcc
aagaaatttgacactttcaaaggggaatgcccaaagtttgtgtttcctcttaactcaaaa
gtcaaagtcattcaaccacgtgttgaaaagaaaaagactgagggtttcatggggcgtata
cgctctgtgtaccctgttgcatctccacaggagtgtaacaatatgcacttgtctaccttg
atgaaatgtaatcattgcgatgaagtttcatggcagacgtgcgactttctgaaagccact
tgtgaacattgtggcactgaaaatttagttattgaaggacctactacatgtgggtaccta
cctactaatgctgtagtgaaaatgccatgtcctgcctgtcaagacccagagattggacct
gagcatagtgttgcagattatcacaaccactcaaacattgaaactcgactccgcaaggga
ggtaggactagatgttttggaggctgtgtgtttgcctatgttggctgctataataagcgt
gcctactgggttcctcgtgctagtgctgatattggctcaggccatactggcattactggt
gacaatgtggagaccttgaatgaggatctccttgagatactgagtcgtgaacgtgttaac
attaacattgttggcgattttcatttgaatgaagaggttgccatcattttggcatctttc
tctgcttctacaagtgcctttattgacactataaagagtcttgattacaagtctttcaaa
accattgttgagtcctgcggtaactataaagttaccaagggaaagcccgtaaaaggtgct
tggaacattggacaacagagatcagttttaacaccactgtgtggttttccctcacaggct
gctggtgttatcagatcaatttttgcgcgcacacttgatgcagcaaaccactcaattcct
gatttgcaaagagcagctgtcaccatacttgatggtatttctgaacagtcattacgtctt
gtcgacgccatggtttatacttcagacctgctcaccaacagtgtcattattatggcatat
gtaactggtggtcttgtacaacagacttctcagtggttgtctaatcttttgggcactact
gttgaaaaactcaggcctatctttgaatggattgaggcgaaacttagtgcaggagttgaa
tttctcaaggatgcttgggagattctcaaatttctcattacaggtgtttttgacatcgtc
aagggtcaaatacaggttgcttcagataacatcaaggattgtgtaaaatgcttcattgat
gttgttaacaaggcactcgaaatgtgcattgatcaagtcactatcgctggcgcaaagttg
cgatcactcaacttaggtgaagtcttcatcgctcaaagcaagggactttaccgtcagtgt
atacgtggcaaggagcagctgcaactactcatgcctcttaaggcaccaaaagaagtaacc
tttcttgaaggtgattcacatgacacagtacttacctctgaggaggttgttctcaagaac
ggtgaactcgaagcactcgagacgcccgttgatagcttcacaaatggagctatcgttggc
acaccagtctgtgtaaatggcctcatgctcttagagattaaggacaaagaacaatactgc
gcattgtctcctggtttactggctacaaacaatgtctttcgcttaaaagggggtgcacca
attaaaggtgtaacctttggagaagatactgtttgggaagttcaaggttacaagaatgtg
agaatcacatttgagcttgatgaacgtgttgacaaagtgcttaatgaaaagtgctctgtc
tacactgttgaatccggtaccgaagttactgagtttgcatgtgttgtagcagaggctgtt
gtgaagactttacaaccagtttctgatctccttaccaacatgggtattgatcttgatgag
tggagtgtagctacattctacttatttgatgatgctggtgaagaaaacttttcatcacgt
atgtattgttccttttaccctccagatgaggaagaagaggacgatgcagagtgtgaggaa
gaagaaattgatgaaacctgtgaacatgagtacggtacagaggatgattatcaaggtctc
cctctggaatttggtgcctcagctgaaacagttcgagttgaggaagaagaagaggaagac
tggctggatgatactactgagcaatcagagattgagccagaaccagaacctacacctgaa
gaaccagttaatcagtttactggttatttaaaacttactgacaatgttgccattaaatgt
gttgacatcgttaaggaggcacaaagtgctaatcctatggtgattgtaaatgctgctaac
atacacctgaaacatggtggtggtgtagcaggtgcactcaacaaggcaaccaatggtgcc
atgcaaaaggagagtgatgattacattaagctaaatggccctcttacagtaggagggtct
tgtttgctttctggacataatcttgctaagaagtgtctgcatgttgttggacctaaccta
aatgcaggtgaggacatccagcttcttaaggcagcatatgaaaatttcaattcacaggac
atcttacttgcaccattgttgtcagcaggcatatttggtgctaaaccacttcagtcttta
caagtgtgcgtgcagacggttcgtacacaggtttatattgcagtcaatgacaaagctctt
tatgagcaggttgtcatggattatcttgataacctgaagcctagagtggaagcacctaaa
caagaggagccaccaaacacagaagattccaaaactgaggagaaatctgtcgtacagaag
cctgtcgatgtgaagccaaaaattaaggcctgcattgatgaggttaccacaacactggaa
gaaactaagtttcttaccaataagttactcttgtttgctgatatcaatggtaagctttac
catgattctcagaacatgcttagaggtgaagatatgtctttccttgagaaggatgcacct
tacatggtaggtgatgttatcactagtggtgatatcacttgtgttgtaataccctccaaa
aaggctggtggcactactgagatgctctcaagagctttgaagaaagtgccagttgatgag
tatataaccacgtaccctggacaaggatgtgctggttatacacttgaggaagctaagact
gctcttaagaaatgcaaatctgcattttatgtactaccttcagaagcacctaatgctaag
gaagagattctaggaactgtatcctggaatttgagagaaatgcttgctcatgctgaagag
acaagaaaattaatgcctatatgcatggatgttagagccataatggcaaccatccaacgt
aagtataaaggaattaaaattcaagagggcatcgttgactatggtgtccgattcttcttt
tatactagtaaagagcctgtagcttctattattacgaagctgaactctctaaatgagccg
cttgtcacaatgccaattggttatgtgacacatggttttaatcttgaagaggctgcgcgc
tgtatgcgttctcttaaagctcctgccgtagtgtcagtatcatcaccagatgctgttact
acatataatggatacctcacttcgtcatcaaagacatctgaggagcactttgtagaaaca
gtttctttggctggctcttacagagattggtcctattcaggacagcgtacagagttaggt
gttgaatttcttaagcgtggtgacaaaattgtgtaccacactctggagagccccgtcgag
tttcatcttgacggtgaggttctttcacttgacaaactaaagagtctcttatccctgcgg
gaggttaagactataaaagtgttcacaactgtggacaacactaatctccacacacagctt
gtggatatgtctatgacatatggacagcagtttggtccaacatacttggatggtgctgat
gttacaaaaattaaacctcatgtaaatcatgagggtaagactttctttgtactacctagt
gatgacacactacgtagtgaagctttcgagtactaccatactcttgatgagagttttctt
ggtaggtacatgtctgctttaaaccacacaaagaaatggaaatttcctcaagttggtggt
ttaacttcaattaaatgggctgataacaattgttatttgtctagtgttttattagcactt
caacagcttgaagtcaaattcaatgcaccagcacttcaagaggcttattatagagcccgt
gctggtgatgctgctaacttttgtgcactcatactcgcttacagtaataaaactgttggc
gagcttggtgatgtcagagaaactatgacccatcttctacagcatgctaatttggaatct
gcaaagcgagttcttaatgtggtgtgtaaacattgtggtcagaaaactactaccttaacg
ggtgtagaagctgtgatgtatatgggtactctatcttatgataatcttaagacaggtgtt
tccattccatgtgtgtgtggtcgtgatgctacacaatatctagtacaacaagagtcttct
tttgttatgatgtctgcaccacctgctgagtataaattacagcaaggtacattcttatgt
gcgaatgagtacactggtaactatcagtgtggtcattacactcatataactgctaaggag
accctctatcgtattgacggagctcaccttacaaagatgtcagagtacaaaggaccagtg
actgatgttttctacaaggaaacatcttacactacaaccatcaagcctgtgtcgtataaa
ctcgatggagttacttacacagagattgaaccaaaattggatgggtattataaaaaggat
aatgcttactatacagagcagcctatagaccttgtaccaactcaaccattaccaaatgcg
agttttgataatttcaaactcacatgttctaacacaaaatttgctgatgatttaaatcaa
atgacaggcttcacaaagccagcttcacgagagctatctgtcacattcttcccagacttg
aatggcgatgtagtggctattgactatagacactattcagcgagtttcaagaaaggtgct
aaattactgcataagccaattgtttggcacattaaccaggctacaaccaagacaacgttc
aaaccaaacacttggtgtttacgttgtctttggagtacaaagccagtagatacttcaaat
tcatttgaagttctggcagtagaagacacacaaggaatggacaatcttgcttgtgaaagt
caacaacccacctctgaagaagtagtggaaaatcctaccatacagaaggaagtcatagag
tgtgacgtgaaaactaccgaagttgtaggcaatgtcatacttaaaccatcagatgaaggt
gttaaagtaacacaagagttaggtcatgaggatcttatggctgcttatgtggaaaacaca
agcattaccattaagaaacctaatgagctttcactagccttaggtttaaaaacaattgcc
actcatggtattgctgcaattaatagtgttccttggagtaaaattttggcttatgtcaaa
ccattcttaggacaagcagcaattacaacatcaaattgcgctaagagattagcacaacgt
gtgtttaacaattatatgccttatgtgtttacattattgttccaattgtgtacttttact
aaaagtaccaattctagaattagagcttcactacctacaactattgctaaaaatagtgtt
aagagtgttgctaaattatgtttggatgccggcattaattatgtgaagtcacccaaattt
tctaaattgttcacaatcgctatgtggctattgttgttaagtatttgcttaggttctcta
atctgtgtaactgctgcttttggtgtactcttatctaattttggtgctccttcttattgt
aatggcgttagagaattgtatcttaattcgtctaacgttactactatggatttctgtgaa
ggttcttttccttgcagcatttgtttaagtggattagactcccttgattcttatccagct
cttgaaaccattcaggtgacgatttcatcgtacaagctagacttgacaattttaggtctg
gccgctgagtgggttttggcatatatgttgttcacaaaattcttttatttattaggtctt
tcagctataatgcaggtgttctttggctattttgctagtcatttcatcagcaattcttgg
ctcatgtggtttatcattagtattgtacaaatggcacccgtttctgcaatggttaggatg
tacatcttctttgcttctttctactacatatggaagagctatgttcatatcatggatggt
tgcacctcttcgacttgcatgatgtgctataagcgcaatcgtgccacacgcgttgagtgt
acaactattgttaatggcatgaagagatctttctatgtctatgcaaatggaggccgtggc
ttctgcaagactcacaattggaattgtctcaattgtgacacattttgcactggtagtaca
ttcattagtgatgaagttgctcgtgatttgtcactccagtttaaaagaccaatcaaccct
actgaccagtcatcgtatattgttgatagtgttgctgtgaaaaatggcgcgcttcacctc
tactttgacaaggctggtcaaaagacctatgagagacatccgctctcccattttgtcaat
ttagacaatttgagagctaacaacactaaaggttcactgcctattaatgtcatagttttt
gatggcaagtccaaatgcgacgagtctgcttctaagtctgcttctgtgtactacagtcag
ctgatgtgccaacctattctgttgcttgaccaagctcttgtatcagacgttggagatagt
actgaagtttccgttaagatgtttgatgcttatgtcgacaccttttcagcaacttttagt
gttcctatggaaaaacttaaggcacttgttgctacagctcacagcgagttagcaaagggt
gtagctttagatggtgtcctttctacattcgtgtcagctgcccgacaaggtgttgttgat
accgatgttgacacaaaggatgttattgaatgtctcaaactttcacatcactctgactta
gaagtgacaggtgacagttgtaacaatttcatgctcacctataataaggttgaaaacatg
acgcccagagatcttggcgcatgtattgactgtaatgcaaggcatatcaatgcccaagta
gcaaaaagtcacaatgtttcactcatctggaatgtaaaagactacatgtctttatctgaa
cagctgcgtaaacaaattcgtagtgctgccaagaagaacaacataccttttagactaact
tgtgctacaactagacaggttgtcaatgtcataactactaaaatctcactcaagggtggt
aagattgttagtacttgttttaaacttatgcttaaggccacattattgtgcgttcttgct
gcattggtttgttatatcgttatgccagtacatacattgtcaatccatgatggttacaca
aatgaaatcattggttacaaagccattcaggatggtgtcactcgtgacatcatttctact
gatgattgttttgcaaataaacatgctggttttgacgcatggtttagccagcgtggtggt
tcatacaaaaatgacaaaagctgccctgtagtagctgctatcattacaagagagattggt
ttcatagtgcctggcttaccgggtactgtgctgagagcaatcaatggtgacttcttgcat
tttctacctcgtgtttttagtgctgttggcaacatttgctacacaccttccaaactcatt
gagtatagtgattttgctacctctgcttgcgttcttgctgctgagtgtacaatttttaag
gatgctatgggcaaacctgtgccatattgttatgacactaatttgctagagggttctatt
tcttatagtgagcttcgtccagacactcgttatgtgcttatggatggttccatcatacag
tttcctaacacttacctggagggttctgttagagtagtaacaacttttgatgctgagtac
tgtagacatggtacatgcgaaaggtcagaagtaggtatttgcctatctaccagtggtaga
tgggttcttaataatgagcattacagagctctatcaggagttttctgtggtgttgatgcg
atgaatctcatagctaacatctttactcctcttgtgcaacctgtgggtgctttagatgtg
tctgcttcagtagtggctggtggtattattgccatattggtgacttgtgctgcctactac
tttatgaaattcagacgtgtttttggtgagtacaaccatgttgttgctgctaatgcactt
ttgtttttgatgtctttcactatactctgtctggtaccagcttacagctttctgccggga
gtctactcagtcttttacttgtacttgacattctatttcaccaatgatgtttcattcttg
gctcaccttcaatggtttgccatgttttctcctattgtgcctttttggataacagcaatc
tatgtattctgtatttctctgaagcactgccattggttctttaacaactatcttaggaaa
agagtcatgtttaatggagttacatttagtaccttcgaggaggctgctttgtgtaccttt
ttgctcaacaaggaaatgtacctaaaattgcgtagcgagacactgttgccacttacacag
tataacaggtatcttgctctatataacaagtacaagtatttcagtggagccttagatact
accagctatcgtgaagcagcttgctgccacttagcaaaggctctaaatgactttagcaac
tcaggtgctgatgttctctaccaaccaccacagacatcaatcacttctgctgttctgcag
agtggttttaggaaaatggcattcccgtcaggcaaagttgaagggtgcatggtacaagta
acctgtggaactacaactcttaatggattgtggttggatgacacagtatactgtccaaga
catgtcatttgcacagcagaagacatgcttaatcctaactatgaagatctgctcattcgc
aaatccaaccatagctttcttgttcaggctggcaatgttcaacttcgtgttattggccat
tctatgcaaaattgtctgcttaggcttaaagttgatacttctaaccctaagacacccaag
tataaatttgtccgtatccaacctggtcaaacattttcagttctagcatgctacaatggt
tcaccatctggtgtttatcagtgtgccatgagacctaatcataccattaaaggttctttc
cttaatggatcatgtggtagtgttggttttaacattgattatgattgcgtgtctttctgc
tatatgcatcatatggagcttccaacaggagtacacgctggtactgacttagaaggtaaa
ttctatggtccatttgttgacagacaaactgcacaggctgcaggtacagacacaaccata
acattaaatgttttggcatggctgtatgctgctgttatcaatggtgataggtggtttctt
aatagattcaccactactttgaatgactttaaccttgtggcaatgaagtacaactatgaa
cctttgacacaagatcatgttgacatattgggacctctttctgctcaaacaggaattgcc
gtcttagatatgtgtgctgctttgaaagagctgctgcagaatggtatgaatggtcgtact
atccttggtagcactattttagaagatgagtttacaccatttgatgttgttagacaatgc
tctggtgttaccttccaaggtaagttcaagaaaattgttaagggcactcatcattggatg
cttttaactttcttgacatcactattgattcttgttcaaagtacacagtggtcactgttt
ttctttgtttacgagaatgctttcttgccatttactcttggtattatggcaattgctgca
tgtgctatgctgcttgttaagcataagcacgcattcttgtgcttgtttctgttaccttct
cttgcaacagttgcttactttaatatggtctacatgcctgctagctgggtgatgcgtatc
atgacatggcttgaattggctgacactagcttgtctggttataggcttaaggattgtgtt
atgtatgcttcagctttagttttgcttattctcatgacagctcgcactgtttatgatgat
gctgctagacgtgtttggacactgatgaatgtcattacacttgtttacaaagtctactat
ggtaatgctttagatcaagctatttccatgtgggccttagttatttctgtaacctctaac
tattctggtgtcgttacgactatcatgtttttagctagagctatagtgtttgtgtgtgtt
gagtattacccattgttatttattactggcaacaccttacagtgtatcatgcttgtttat
tgtttcttaggctattgttgctgctgctactttggccttttctgtttactcaaccgttac
ttcaggcttactcttggtgtttatgactacttggtctctacacaagaatttaggtatatg
aactcccaggggcttttgcctcctaagagtagtattgatgctttcaagcttaacattaag
ttgttgggtattggaggtaaaccatgtatcaaggttgctactgtacagtctaaaatgtct
gacgtaaagtgcacatctgtggtactgctctcggttcttcaacaacttagagtagagtca
tcttctaaattgtgggcacaatgtgtacaactccacaatgatattcttcttgcaaaagac
acaactgaagctttcgagaagatggtttctcttttgtctgttttgctatccatgcagggt
gctgtagacattaataggttgtgcgaggaaatgctcgataaccgtgctactcttcaggct
attgcttcagaatttagttctttaccatcatatgccgcttatgccactgcccaggaggcc
tatgagcaggctgtagctaatggtgattctgaagtcgttctcaaaaagttaaagaaatct
ttgaatgtggctaaatctgagtttgaccgtgatgctgccatgcaacgcaagttggaaaag
atggcagatcaggctatgacccaaatgtacaaacaggcaagatctgaggacaagagggca
aaagtaactagtgctatgcaaacaatgctcttcactatgcttaggaagcttgataatgat
gcacttaacaacattatcaacaatgcgcgtgatggttgtgttccactcaacatcatacca
ttgactacagcagccaaactcatggttgttgtccctgattatggtacctacaagaacact
tgtgatggtaacacctttacatatgcatctgcactctgggaaatccagcaagttgttgat
gcggatagcaagattgttcaacttagtgaaattaacatggacaattcaccaaatttggct
tggcctcttattgttacagctctaagagccaactcagctgttaaactacagaataatgaa
ctgagtccagtagcactacgacagatgtcctgtgcggctggtaccacacaaacagcttgt
actgatgacaatgcacttgcctactataacaattcgaagggaggtaggtttgtgctggca
ttactatcagaccaccaagatctcaaatgggctagattccctaagagtgatggtacaggt
acaatttacacagaactggaaccaccttgtaggtttgttacagacacaccaaaagggcct
aaagtgaaatacttgtacttcatcaaaggcttaaacaacctaaatagaggtatggtgctg
ggcagtttagctgctacagtacgtcttcaggctggaaatgctacagaagtacctgccaat
tcaactgtgctttccttctgtgcttttgcagtagaccctgctaaagcatataaggattac
ctagcaagtggaggacaaccaatcaccaactgtgtgaagatgttgtgtacacacactggt
acaggacaggcaattactgtaacaccagaagctaacatggaccaagagtcctttggtggt
gcttcatgttgtctgtattgtagatgccacattgaccatccaaatcctaaaggattctgt
gacttgaaaggtaagtacgtccaaatacctaccacttgtgctaatgacccagtgggtttt
acacttagaaacacagtctgtaccgtctgcggaatgtggaaaggttatggctgtagttgt
gaccaactccgcgaacccttgatgcagtctgcggatgcatcaacgtttttaaaccgggtt
tgcggtgtaagtgcagcccgtcttacaccgtgcggcacaggcactagtactgatgtcgtc
tacagggcttttgatatttacaacgaaaaagttgctggttttgcaaagttcctaaaaact
aattgctgtcgcttccaggagaaggatgaggaaggcaatttattagactcttactttgta
gttaagaggcatactatgtctaactaccaacatgaagagactatttataacttggttaaa
gattgtccagcggttgctgtccatgactttttcaagtttagagtagatggtgacatggta
ccacatatatcacgtcagcgtctaactaaatacacaatggctgatttagtctatgctcta
cgtcattttgatgagggtaattgtgatacattaaaagaaatactcgtcacatacaattgc
tgtgatgatgattatttcaataagaaggattggtatgacttcgtagagaatcctgacatc
ttacgcgtatatgctaacttaggtgagcgtgtacgccaatcattattaaagactgtacaa
ttctgcgatgctatgcgtgatgcaggcattgtaggcgtactgacattagataatcaggat
cttaatgggaactggtacgatttcggtgatttcgtacaagtagcaccaggctgcggagtt
cctattgtggattcatattactcattgctgatgcccatcctcactttgactagggcattg
gctgctgagtcccatatggatgctgatctcgcaaaaccacttattaagtgggatttgctg
aaatatgattttacggaagagagactttgtctcttcgaccgttattttaaatattgggac
cagacataccatcccaattgtattaactgtttggatgataggtgtatccttcattgtgca
aactttaatgtgttattttctactgtgtttccacctacaagttttggaccactagtaaga
aaaatatttgtagatggtgttccttttgttgtttcaactggataccattttcgtgagtta
ggagtcgtacataatcaggatgtaaacttacatagctcgcgtctcagtttcaaggaactt
ttagtgtatgctgctgatccagctatgcatgcagcttctggcaatttattgctagataaa
cgcactacatgcttttcagtagctgcactaacaaacaatgttgcttttcaaactgtcaaa
cccggtaattttaataaagacttttatgactttgctgtgtctaaaggtttctttaaggaa
ggaagttctgttgaactaaaacacttcttctttgctcaggatggcaacgctgctatcagt
gattatgactattatcgttataatctgccaacaatgtgtgatatcagacaactcctattc
gtagttgaagttgttgataaatactttgattgttacgatggtggctgtattaatgccaac
caagtaatcgttaacaatctggataaatcagctggtttcccatttaataaatggggtaag
gctagactttattatgactcaatgagttatgaggatcaagatgcacttttcgcgtatact
aagcgtaatgtcatccctactataactcaaatgaatcttaagtatgccattagtgcaaag
aatagagctcgcaccgtagctggtgtctctatctgtagtactatgacaaatagacagttt
catcagaaattattgaagtcaatagccgccactagaggagctactgtggtaattggaaca
agcaagttttacggtggctggcataatatgttaaaaactgtttacagtgatgtagaaact
ccacaccttatgggttgggattatccaaaatgtgacagagccatgcctaacatgcttagg
ataatggcctctcttgttcttgctcgcaaacataacacttgctgtaacttatcacaccgt
ttctacaggttagctaacgagtgtgcgcaagtattaagtgagatggtcatgtgtggcggc
tcactatatgttaaaccaggtggaacatcatccggtgatgctacaactgcttatgctaat
agtgtctttaacatttgtcaagctgttacagccaatgtaaatgcacttctttcaactgat
ggtaataagatagctgacaagtatgtccgcaatctacaacacaggctctatgagtgtctc
tatagaaatagggatgttgatcatgaattcgtggatgagttttacgcttacctgcgtaaa
catttctccatgatgattctttctgatgatgccgttgtgtgctataacagtaactatgcg
gctcaaggtttagtagctagcattaagaactttaaggcagttctttattatcaaaataat
gtgttcatgtctgaggcaaaatgttggactgagactgaccttactaaaggacctcacgaa
ttttgctcacagcatacaatgctagttaaacaaggagatgattacgtgtacctgccttac
ccagatccatcaagaatattaggcgcaggctgttttgtcgatgatattgtcaaaacagat
ggtacacttatgattgaaaggttcgtgtcactggctattgatgcttacccacttacaaaa
catcctaatcaggagtatgctgatgtctttcacttgtatttacaatacattagaaagtta
catgatgagcttactggccacatgttggacatgtattccgtaatgctaactaatgataac
acctcacggtactgggaacctgagttttatgaggctatgtacacaccacatacagtcttg
caggctgtaggtgcttgtgtattgtgcaattcacagacttcacttcgttgcggtgcctgt
attaggagaccattcctatgttgcaagtgctgctatgaccatgtcatttcaacatcacac
aaattagtgttgtctgttaatccctatgtttgcaatgccccaggttgtgatgtcactgat
gtgacacaactgtatctaggaggtatgagctattattgcaagtcacataagcctcccatt
agttttccattatgtgctaatggtcaggtttttggtttatacaaaaacacatgtgtaggc
agtgacaatgtcactgacttcaatgcgatagcaacatgtgattggactaatgctggcgat
tacatacttgccaacacttgtactgagagactcaagcttttcgcagcagaaacgctcaaa
gccactgaggaaacatttaagctgtcatatggtattgccactgtacgcgaagtactctct
gacagagaattgcatctttcatgggaggttggaaaacctagaccaccattgaacagaaac
tatgtctttactggttaccgtgtaactaaaaatagtaaagtacagattggagagtacacc
tttgaaaaaggtgactatggtgatgctgttgtgtacagaggtactacgacatacaagttg
aatgttggtgattactttgtgttgacatctcacactgtaatgccacttagtgcacctact
ctagtgccacaagagcactatgtgagaattactggcttgtacccaacactcaacatctca
gatgagttttctagcaatgttgcaaattatcaaaaggtcggcatgcaaaagtactctaca
ctccaaggaccacctggtactggtaagagtcattttgccatcggacttgctctctattac
ccatctgctcgcatagtgtatacggcatgctctcatgcagctgttgatgccctatgtgaa
aaggcattaaaatatttgcccatagataaatgtagtagaatcatacctgcgcgtgcgcgc
gtagagtgttttgataaattcaaagtgaattcaacactagaacagtatgttttctgcact
gtaaatgcattgccagaaacaactgctgacattgtagtctttgatgaaatctctatggct
actaattatgacttgagtgttgtcaatgctagacttcgtgcaaaacactacgtctatatt
ggcgatcctgctcaattaccagccccccgcacattgctgactaaaggcacactagaacca
gaatattttaattcagtgtgcagacttatgaaaacaataggtccagacatgttccttgga
acttgtcgccgttgtcctgctgaaattgttgacactgtgagtgctttagtttatgacaat
aagctaaaagcacacaaggataagtcagctcaatgcttcaaaatgttctacaaaggtgtt
attacacatgatgtttcatctgcaatcaacagacctcaaataggcgttgtaagagaattt
cttacacgcaatcctgcttggagaaaagctgtttttatctcaccttataattcacagaac
gctgtagcttcaaaaatcttaggattgcctacgcagactgttgattcatcacagggttct
gaatatgactatgtcatattcacacaaactactgaaacagcacactcttgtaatgtcaac
cgcttcaatgtggctatcacaagggcaaaaattggcattttgtgcataatgtctgataga
gatctttatgacaaactgcaatttacaagtctagaaataccacgtcgcaatgtggctaca
ttacaagcagaaaatgtaactggactttttaaggactgtagtaagatcattactggtctt
catcctacacaggcacctacacacctcagcgttgatataaagttcaagactgaaggatta
tgtgttgacataccaggcataccaaaggacatgacctaccgtagactcatctctatgatg
ggtttcaaaatgaattaccaagtcaatggttaccctaatatgtttatcacccgcgaagaa
gctattcgtcacgttcgtgcgtggattggctttgatgtagagggctgtcatgcaactaga
gatgctgtgggtactaacctacctctccagctaggattttctacaggtgttaacttagta
gctgtaccgactggttatgttgacactgaaaataacacagaattcaccagagttaatgca
aaacctccaccaggtgaccagtttaaacatcttataccactcatgtataaaggcttgccc
tggaatgtagtgcgtattaagatagtacaaatgctcagtgatacactgaaaggattgtca
gacagagtcgtgttcgtcctttgggcgcatggctttgagcttacatcaatgaagtacttt
gtcaagattggacctgaaagaacgtgttgtctgtgtgacaaacgtgcaacttgcttttct
acttcatcagatacttatgcctgctggaatcattctgtgggttttgactatgtctataac
ccatttatgattgatgttcagcagtggggctttacgggtaaccttcagagtaaccatgac
caacattgccaggtacatggaaatgcacatgtggctagttgtgatgctatcatgactaga
tgtttagcagtccatgagtgctttgttaagcgcgttgattggtctgttgaataccctatt
ataggagatgaactgagggttaattctgcttgcagaaaagtacaacacatggttgtgaag
tctgcattgcttgctgataagtttccagttcttcatgacattggaaatccaaaggctatc
aagtgtgtgcctcaggctgaagtagaatggaagttctacgatgctcagccatgtagtgac
aaagcttacaaaatagaggaactcttctattcttatgctacacatcacgataaattcact
gatggtgtttgtttgttttggaattgtaacgttgatcgttacccagccaatgcaattgtg
tgtaggtttgacacaagagtcttgtcaaacttgaacttaccaggctgtgatggtggtagt
ttgtatgtgaataagcatgcattccacactccagctttcgataaaagtgcatttactaat
ttaaagcaattgcctttcttttactattctgatagtccttgtgagtctcatggcaaacaa
gtagtgtcggatattgattatgttccactcaaatctgctacgtgtattacacgatgcaat
ttaggtggtgctgtttgcagacaccatgcaaatgagtaccgacagtacttggatgcatat
aatatgatgatttctgctggatttagcctatggatttacaaacaatttgatacttataac
ctgtggaatacatttaccaggttacagagtttagaaaatgtggcttataatgttgttaat
aaaggacactttgatggacacgccggcgaagcacctgtttccatcattaataatgctgtt
tacacaaaggtagatggtattgatgtggagatctttgaaaataagacaacacttcctgtt
aatgttgcatttgagctttgggctaagcgtaacattaaaccagtgccagagattaagata
ctcaataatttgggtgttgatatcgctgctaatactgtaatctgggactacaaaagagaa
gccccagcacatgtatctacaataggtgtctgcacaatgactgacattgccaagaaacct
actgagagtgcttgttcttcacttactgtcttgtttgatggtagagtggaaggacaggta
gacctttttagaaacgcccgtaatggtgttttaataacagaaggttcagtcaaaggtcta
acaccttcaaagggaccagcacaagctagcgtcaatggagtcacattaattggagaatca
gtaaaaacacagtttaactactttaagaaagtagacggcattattcaacagttgcctgaa
acctactttactcagagcagagacttagaggattttaagcccagatcacaaatggaaact
gactttctcgagctcgctatggatgaattcatacagcgatataagctcgagggctatgcc
ttcgaacacatcgtttatggagatttcagtcatggacaacttggcggtcttcatttaatg
ataggcttagccaagcgctcacaagattcaccacttaaattagaggattttatccctatg
gacagcacagtgaaaaattacttcataacagatgcgcaaacaggttcatcaaaatgtgtg
tgttctgtgattgatcttttacttgatgactttgtcgagataataaagtcacaagatttg
tcagtgatttcaaaagtggtcaaggttacaattgactatgctgaaatttcattcatgctt
tggtgtaaggatggacatgttgaaaccttctacccaaaactacaagcaagtcaagcgtgg
caaccaggtgttgcgatgcctaacttgtacaagatgcaaagaatgcttcttgaaaagtgt
gaccttcagaattatggtgaaaatgctgttataccaaaaggaataatgatgaatgtcgca
aagtatactcaactgtgtcaatacttaaatacacttactttagctgtaccctacaacatg
agagttattcactttggtgctggctctgataaaggagttgcaccaggtacagctgtgctc
agacaatggttgccaactggcacactacttgtcgattcagatcttaatgacttcgtctcc
gacgcagattctactttaattggagactgtgcaacagtacatacggctaataaatgggac
cttattattagcgatatgtatgaccctaggaccaaacatgtgacaaaagagaatgactct
aaagaagggtttttcacttatctgtgtggatttataaagcaaaaactagccctgggtggt
tctatagctgtaaagataacagagcattcttggaatgctgacctttacaagcttatgggc
catttctcatggtggacagcttttgttacaaatgtaaatgcatcatcatcggaagcattt
ttaattggggctaactatcttggcaagccgaaggaacaaattgatggctataccatgcat
gctaactacattttctggaggaacacaaatcctatccagttgtcttcctattcactcttt
gacatgagcaaatttcctcttaaattaagaggaactgctgtaatgtctcttaaggagaat
caaatcaatgatatgatttattctcttctggaaaaaggtaggcttatcattagagaaaac
aacagagttgtggtttcaagtgatattcttgttaacaactaa

DBGET integrated database retrieval system